Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.68
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20605920 Results indicate a role for RINGO C in the mitotic checkpoint, which might be mediated by defective recruitment of SAC components and deregulation of the activity of Aurora kinase B.
18802405 CDK-Speedy/Ringo C complexes positively regulate cell cycle progression during the late S and G(2) phases of the cell cycle.

AA Sequence

MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSF      1 - 70
VQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKD     71 - 140
WCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQVPVRLPRGPG    141 - 210
LSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYS    211 - 280
LRIFPKPPARPGH                                                             281 - 293
//

Text Mined References (5)

PMID Year Title
20605920 2010 RINGO C is required to sustain the spindle-assembly checkpoint.
18802405 2008 Speedy/Ringo C regulates S and G2 phase progression in human cells.
15611625 2005 Identification and comparative analysis of multiple mammalian Speedy/Ringo proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.