Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q5MJ09 Q0ZNK4
Symbols CT11.8
SPANX-N3

Gene

 Compartment GO Term (2)

Protein-protein Interaction (7)

AA Sequence

MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLEN      1 - 70
EQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGE     71 - 140
D//

Text Mined References (6)

PMID Year Title