Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.37549835998499E-7
glioblastoma 5572 2.4157597922318E-7
pediatric high grade glioma 2712 1.33849897312406E-5
pilocytic astrocytoma 3086 2.39708666306682E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 4.60051774325495E-4
primitive neuroectodermal tumor 3031 0.00126839058835574
posterior fossa group B ependymoma 1530 0.00213288236754088
atypical teratoid/rhabdoid tumor 1095 0.00249251013396456
group 4 medulloblastoma 1875 0.00295561509986164
primary Sjogren syndrome 789 0.00403106317597548
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 4.463 2.2

Expression

Synonym

Accession Q5M7Z0 Q8N7D0 Q96IZ9 Q9Y686
Symbols PTD016

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRAMQANRSQLHSPPGTGSSEDASTPQCVHTRLTGE      1 - 70
GSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSS     71 - 140
FSEFRYLFKWLQKSLPYILILSVKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKIQCAWLLV    141 - 210
FLAGSSVLLYYTFHSQSLYYSLIFLNPTLDHLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFK    211 - 280
SKGYWYMLLEELCQYYRTFVPIPVWFRYLISYGEFGNVTRWSLGILLALLYLILKLLEFFGHLRTFRQVL    281 - 350
RIFFTQPSYGVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHI    351 - 420
NKWKDGATSSHLQIY                                                           421 - 435
//

Text Mined References (8)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17074343 2006 Identification of ten novel genes involved in human spermatogenesis by microarray analysis of testicular tissue.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.