Property Summary

NCBI Gene PubMed Count 22
Grant Count 31
R01 Count 21
Funding $7,552,867.67
PubMed Score 7.85
PubTator Score 29.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Gene RIF (12)

PMID Text
25706089 Study demonstrated that binding of clozapine or olanzapine to the 5-HT7 receptor leads to antagonist-mediated lysosomal degradation by exposing key residues in the C-terminal tail that interact with GASP-1
23082996 Data suggest that specific serine/threonine residues in DRD2 (dopamine receptor D2) are involved in regulation of DRD2 endocytosis by GRK2 (G-protein coupled receptor kinase 2) and GASP1.
22483848 GASP1 was identified as a potential new serum and biomarker for brain, pancreatic, lung, and breast cancers, and gliomas.
21900845 LIR was able to induce gains in 1RM and quadriceps CSA similar to those observed after traditional HI. These responses may be related to the concomitant decrease in MSTN and increase in FLST isoforms, GASP-1, and SMAD-7 mRNA gene expression.
21791203 These studies identify GASP-1 as a potential new serum and tumor biomarker for breast cancer.
21718301 GASP-1 is a key regulator of the trafficking and, by extension, functional expression of GPR55
21030592 following this endocytosis the D(3) dopamine receptors fail to recycle and are instead targeted for degradation through an interaction with the G protein-coupled receptor (GPCR)-associated sorting protein-1 (GASP-1)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20394773 This review describes the discovery of GASPs, their major features, interacting partners, functions and possible involvement in pathological situations including neurodegenerative diseases and cancer.
19237393 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTGAEIESGAQVKPEKKPGEEVVGGAEIENDVPLVVRPKVRTQAQIMPGARPKNKSKVMPGASTKVETSA      1 - 70
VGGARPKSKAKAIPVSRFKEEAQMWAQPRFGAERLSKTERNSQTNIIASPLVSTDSVLVAKTKYLSEDRE     71 - 140
LVNTDTESFPRRKAHYQAGFQPSFRSKEETNMGSWCCPRPTSKQEASPNSDFKWVDKSVSSLFWSGDEVT    141 - 210
AKFHPGNRVKDSNRSMHMANQEANTMSRSQTNQELYIASSSGSEDESVKTPWFWARDKTNTWSGPREDPN    211 - 280
SRSRFRSKKEVYVESSSGSEHEDHLESWFGAGKEAKFRSKMRAGKEANNRARHRAKREACIDFMPGSIDV    281 - 350
IKKESCFWPEENANTFSRPMIKKEARARAMTKEEAKTKARARAKQEARSEEEALIGTWFWATDESSMADE    351 - 420
ASIESSLQVEDESIIGSWFWTEEEASMGTGASSKSRPRTDGERIGDSLFGAREKTSMKTGAEATSESILA    421 - 490
ADDEQVIIGSWFWAGEEVNQEAEEETIFGSWFWVIDAASVESGVGVSCESRTRSEEEEVIGPWFWSGEQV    491 - 560
DIEAGIGEEARPGAEEETIFGSWFWAENQTYMDCRAETSCDTMQGAEEEEPIIGSWFWTRVEACVEGDVN    561 - 630
SKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEE    631 - 700
EDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEEETIINSWFWKEDEAISEATDREESR    701 - 770
PEAEEGDIIGSWFWAGEEDRLEPAAETREEDRLAAEKEGIVGSWFGAREETIRREAGSCSKSSPKAEEEE    771 - 840
VIIGSWFWEEEASPEAVAGVGFESKPGTEEEEITVGSWFWPEEEASIQAGSQAVEEMESETEEETIFGSW    841 - 910
FWDGKEVSEEAGPCCVSKPEDDEEMIVESWFWSRDKAIKETGTVATCESKPENEEGAIVGSWFEAEDEVD    911 - 980
NRTDNGSNCGSRTLADEDEAIVGSWFWAGDEAHFESNPSPVFRAICRSTCSVEQEPDPSRRPQSWEEVTV    981 - 1050
QFKPGPWGRVGFPSISPFRFPKEAASLFCEMFGGKPRNMVLSPEGEDQESLLQPDQPSPEFPFQYDPSYR   1051 - 1120
SVQEIREHLRAKESTEPESSSCNCIQCELKIGSEEFEELLLLMEKIRDPFIHEISKIAMGMRSASQFTRD   1121 - 1190
FIRDSGVVSLIETLLNYPSSRVRTSFLENMIRMAPPYPNLNIIQTYICKVCEETLAYSVDSPEQLSGIRM   1191 - 1260
IRHLTTTTDYHTLVANYMSGFLSLLATGNAKTRFHVLKMLLNLSENLFMTKELLSAEAVSEFIGLFNREE   1261 - 1330
TNDNIQIVLAIFENIGNNIKKETVFSDDDFNIEPLISAFHKVEKFAKELQGKTDNQNDPEGDQEN        1331 - 1395
//

Text Mined References (22)

PMID Year Title
25706089 2015 Downregulation of 5-HT7 Serotonin Receptors by the Atypical Antipsychotics Clozapine and Olanzapine. Role of Motifs in the C-Terminal Domain and Interaction with GASP-1.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23082996 2013 ARF6 and GASP-1 are post-endocytic sorting proteins selectively involved in the intracellular trafficking of dopamine D? receptors mediated by GRK and PKC in transfected cells.
22483848 2012 G-protein coupled receptor-associated sorting protein 1 (GASP-1), a ubiquitous tumor marker.
21900845 2012 Strength training with blood flow restriction diminishes myostatin gene expression.
21791203 2011 G-protein coupled receptor-associated sorting protein 1 (GASP-1), a potential biomarker in breast cancer.
21718301 2012 The GPCR-associated sorting protein 1 regulates ligand-induced down-regulation of GPR55.
21030592 2011 Dopamine D(3) receptors are down-regulated following heterologous endocytosis by a specific interaction with G protein-coupled receptor-associated sorting protein-1.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20394773 2010 Identification and biological significance of G protein-coupled receptor associated sorting proteins (GASPs).
More...