Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5JX71 Q05C43
Symbols C20orf106
dJ1153D9.3

Gene

AA Sequence

MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVQYGEHFRIRQNLPEHTQGWLGSKWLWLLFVVVPF      1 - 70
VILQCQRDSEKNKEQSPPGLRGGQLHSPLKKKRNASPNKDCAFNTLMELEVELMKFVSKVRNLKRAMATG     71 - 140
SGSNLRLRKSEMPADPYHVTICEIWGEESSS                                           141 - 171
//

Text Mined References (7)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.