Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58
PubTator Score 0.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Leprosy 73 0.0 3.0
Disease Target Count Z-score Confidence
Vogt-Koyanagi-Harada disease 9 4.407 2.2

AA Sequence

MAEKILEKLDVLDKQAEIILARRTKINRLQSEGRKTTMAIPLTFDFQLEFEEALATSASKAISKIKEDKS      1 - 70
CSITKSKMHVSFKCEPEPRKSNFEKSNLRPFFIQTNVKNKESESTAQIEKKPRKPLDSVGLLEGDRNKRK     71 - 140
KSPQMNDFNIKENKSVRNYQLSKYRSVRKKSLLPLCFEDELKNPHAKIVNVSPTKTVTSHMEQKDTNPII    141 - 210
FHDTEYVRMLLLTKNRFSSHPLENENIYPHKRTNFILERNCEILKSIIGNQSISLFKPQKTMPTVQRKDI    211 - 280
QIPMSFKAGHTTVDDKLKKKTNKQTLENRSWNTLYNFSQNFSSLTKQFVGYLDKAVIHEMSAQTGKFERM    281 - 350
FSAGKPTSIPTSSALPVKCYSKPFKYIYELNNVTPLDNLLNLSNEILNAS                        351 - 400
//

Text Mined References (9)

PMID Year Title