Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.02
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Noonan syndrome 34 3.409 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -2.000 3.9e-02
malignant mesothelioma 1.100 1.9e-06
osteosarcoma -1.098 5.1e-03
ovarian cancer 1.100 3.6e-04
sonic hedgehog group medulloblastoma 1.100 2.4e-04

Gene RIF (3)

AA Sequence

MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTY      1 - 70
AVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEK     71 - 140
AAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRV    141 - 210
TYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFA    211 - 280
EVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFM    281 - 350
QVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC                         351 - 399
//

Text Mined References (20)

PMID Year Title