Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.42
PubTator Score 1.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.098 0.005
sonic hedgehog group medulloblastoma 1.100 0.000
acute myeloid leukemia -2.000 0.039
ovarian cancer 1.100 0.000

Gene

PDB

3T5X  

Gene RIF (3)

PMID Text
24291146 First discovery of specific novel functions for PCID2 other than mRNA export and components of the TREX-2 complex serve alternative shared roles in the regulation of nuclear transport and cell cycle progression.
24167073 Pcid2 is present in the CBP/p300-EID1 complex to control the switch balance of mouse and human embryonic stem cells through modulation of EID1 degradation.
17672918 validated occurrence of an unusual TG 3' splice site in intron 2

AA Sequence

MAHITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFAAHLRCTY      1 - 70
AVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNADQQLVKKGKSKVGDMLEK     71 - 140
AAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRV    141 - 210
TYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFA    211 - 280
EVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFM    281 - 350
QVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC                         351 - 399
//

Text Mined References (20)

PMID Year Title
25914122 2015 Conformational stability of PCID2 upon DSS1 binding with molecular dynamics simulation.
25416956 2014 A proteome-scale map of the human interactome network.
24896180 2014 BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
24291146 2014 Human TREX2 components PCID2 and centrin 2, but not ENY2, have distinct functions in protein export and co-localize to the centrosome.
24167073 2014 Pcid2 inactivates developmental genes in human and mouse embryonic stem cells to sustain their pluripotency by modulation of EID1 stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
21269460 2011 Initial characterization of the human central proteome.
20870947 2010 Critical role of Pcid2 in B cell survival through the regulation of MAD2 expression.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
More...