Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.03
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.32515474404968E-8
Pick disease 1893 8.62393126016382E-5
medulloblastoma, large-cell 6234 2.90674129812155E-4
osteosarcoma 7933 0.00571887555693149
lung cancer 4473 0.0150342090500746

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.100 0.000
osteosarcoma -1.438 0.006
medulloblastoma, large-cell -1.200 0.000
lung cancer -1.500 0.015
Pick disease -1.200 0.000

Synonym

Accession Q5JUW0 A8K0Y8 B3KU22 Q96EA3 Q9NXB1
Symbols ZNF673

Gene

  Ortholog (1)

Species Source
Macaque OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMAD      1 - 70
GGTPVRTCAGEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRTCRKSIYLSTEFDSVR     71 - 140
QRLPKYYSWEKAFKTSFKLSWSKWKLCKKER                                           141 - 171
//

Text Mined References (7)

PMID Year Title
16385466 2006 ZNF674: a new kruppel-associated box-containing zinc-finger gene involved in nonsyndromic X-linked mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944989 2002 An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders.