Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.33464091541891E-5
interstitial cystitis 2299 0.00312813911912098
spina bifida 1064 0.026905982052635

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.815 0.000
interstitial cystitis 1.500 0.003
spina bifida 1.143 0.027

Synonym

Accession Q5JUQ0 Q86VQ9 Q9H7P4
Symbols C9orf59

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTPHFR      1 - 70
ASAQVVMPPIPKKETWVVGWIQACSHMEFYNQYGEQGMSSWELPDLQEGKIQAISDSDGVNYPWYGNTTE     71 - 140
TCTIVGPTKRDSKFIISMNDNFYPSVTWAVPVSESNVAKLTNIYRDQSFTTWLVATNTSTNDMIILQTLH    141 - 210
WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNANDAQVLMWRPKYGQPLVVIPP    211 - 280
KHR                                                                       281 - 283
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214971 2000 Characterization of long cDNA clones from human adult spleen.