Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.3e-05
interstitial cystitis 2312 3.1e-03
spina bifida 1074 2.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.500 3.1e-03
osteosarcoma -1.815 3.3e-05
spina bifida 1.143 2.7e-02

AA Sequence

MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTPHFR      1 - 70
ASAQVVMPPIPKKETWVVGWIQACSHMEFYNQYGEQGMSSWELPDLQEGKIQAISDSDGVNYPWYGNTTE     71 - 140
TCTIVGPTKRDSKFIISMNDNFYPSVTWAVPVSESNVAKLTNIYRDQSFTTWLVATNTSTNDMIILQTLH    141 - 210
WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNANDAQVLMWRPKYGQPLVVIPP    211 - 280
KHR                                                                       281 - 283
//

Text Mined References (5)

PMID Year Title