Property Summary

NCBI Gene PubMed Count 11
Grant Count 16
R01 Count 13
Funding $968,288.93
PubMed Score 12.57
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.208 0.012
ependymoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma -1.100 0.000
primitive neuroectodermal tumor -1.300 0.000
psoriasis -4.800 0.000

Gene RIF (6)

PMID Text
26375665 the expression of Sohlh genes in human tissues
25527234 In Chinese and Serbian patients with primary ovarian insufficiency, SOHLH1 was found to be a candidate gene.
25463635 No association between SOHLH1 SNPs and azoospermia risk in the Chinese population.
20506135 Findings indicate that a splice-acceptor site mutation that probably causes a nonfunctional SOHLH1 protein results in nonobstructive azoospermia by the lack of normal spermatogenesis.
20506135 Observational study of gene-disease association. (HuGE Navigator)
16690745 Sohlh1 and Lhx8 are two germ cell-specific, critical regulators of oogenesis

AA Sequence

MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSARGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS      1 - 70
LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI     71 - 140
QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC    141 - 210
QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGPLAMGAAPLGEP    211 - 280
AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA                          281 - 328
//

Text Mined References (15)

PMID Year Title
26375665 2015 Immunohistochemical Study of Expression of Sohlh1 and Sohlh2 in Normal Adult Human Tissues.
25527234 2015 Transcription factor SOHLH1 potentially associated with primary ovarian insufficiency.
25463635 2015 Association of genetic variants in SOHLH1 and SOHLH2 with non-obstructive azoospermia risk in the Chinese population.
23784828 2013 Transcriptional control of KIT gene expression during germ cell development.
23346521 2012 Transcription factors in the maintenance and survival of primordial follicles.
22328502 2012 SOHLH1 and SOHLH2 control Kit expression during postnatal male germ cell development.
20506135 2010 Mutations in SOHLH1 gene associate with nonobstructive azoospermia.
17305537 2007 Candidate genes for premature ovarian failure.
16690745 2006 Oogenesis requires germ cell-specific transcriptional regulators Sohlh1 and Lhx8.
16564520 2006 Sohlh1 is essential for spermatogonial differentiation.
More...