Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.94
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 7.6e-06
ependymoma -1.100 3.7e-08
group 3 medulloblastoma -1.100 2.1e-02
osteosarcoma 1.208 1.2e-02
primitive neuroectodermal tumor -1.300 2.6e-04
psoriasis -4.800 5.7e-28

Gene RIF (6)

AA Sequence

MASRCSEPYPEVSRIPTVRGCNGSLSGALSCCEDSARGSGPPKAPTVAEGPSSCLRRNVISERERRKRMS      1 - 70
LSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASSKEMWHSLQEDVLQLTLSSQI     71 - 140
QAGVPDPGTGASSGTRTPDVKAFLESPWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLC    141 - 210
QVRGGLPPFSEPSSLVPWPPGRSLPKAVRPPLSWPPFSQQQTLPVMSGEALGWLGQAGPLAMGAAPLGEP    211 - 280
AKEDPMLAQEAGSALGSDVDDGTSFLLTAGPSSWPGEWGPGFRAGPPA                          281 - 328
//

Text Mined References (15)

PMID Year Title