Property Summary

NCBI Gene PubMed Count 5
PubMed Score 58.61
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.200 2.8e-03
Astrocytoma, Pilocytic 1.300 4.5e-06
ductal carcinoma in situ -1.500 1.0e-02
gastric carcinoma 1.700 1.5e-02
glioblastoma 1.400 2.6e-06
group 3 medulloblastoma 1.100 2.6e-02
interstitial cystitis 1.500 1.3e-03
invasive ductal carcinoma -2.000 1.2e-02
lung adenocarcinoma -1.100 1.0e-08
lung carcinoma -2.700 1.7e-26
non-small cell lung cancer -1.584 5.7e-20
osteosarcoma -1.685 2.0e-03
ovarian cancer -5.000 1.4e-13
pancreatic cancer 1.100 2.8e-02
pituitary cancer -3.900 5.6e-09
primary pancreatic ductal adenocarcinoma 1.214 3.0e-03
primary Sjogren syndrome 1.800 4.6e-04
primitive neuroectodermal tumor 1.200 1.7e-03
subependymal giant cell astrocytoma 2.311 4.1e-02
ulcerative colitis 2.100 9.8e-06

AA Sequence

MAEVRKFTKRLSKPGTAAELRQSVSEAVRGSVVLEKAKVVEPLDYENVIAQRKTQIYSDPLRDLLMFPME      1 - 70
DISISVIGRQRRTVQSTVPEDAEKRAQSLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSLRPEKIP     71 - 140
NHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNSTITVTMKVFKRRYFYLTQLPDGSYILNSYKD    141 - 210
EKNSKESKGCIYLDACIDVVQCPKMRRHAFELKMLDKYSHYLAAETEQEMEEWLITLKKIIQINTDSLVQ    211 - 280
EKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFS    281 - 350
GIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINLALFDVKNNCKISADFHVDLN    351 - 420
PPSVREMLWGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVARIEKVLQGNIT    421 - 490
HCAEPYIKNSDPVKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLDGRFSPLYKQDSSKLS    491 - 560
SEDILKLLSEYKKPEKTKLQIIPGQLNITVECVPVDLSNCITSSYVPLKPFEKNCQNITVEVEEFVPEMT    561 - 630
KYCYPFTIYKNHLYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDASALKCIYGKPAGSVFTTNAYAV    631 - 700
VSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCEINTKGTTKKQDTVETPVGFAWVPLLKDGRIIT    701 - 770
FEQQLPVSANLPPGYLNLNDAESRRQCNVDIKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQLIQS    771 - 840
GSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVLTNMTHEDDVPINCTMVLLHIVSKCHEEGLDS    841 - 910
YLRSFIKYSFRPEKPSAPQAQLIHETLATTMIAILKQSADFLSINKLLKYSWFFFEIIAKSMATYLLEEN    911 - 980
KIKLPRGQRFPETYHHVLHSLLLAIIPHVTIRYAEIPDESRNVNYSLASFLKRCLTLMDRGFIFNLINDY    981 - 1050
ISGFSPKDPKVLAEYKFEFLQTICNHEHYIPLNLPMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLL   1051 - 1120
RETSIALQDNYEIRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSC   1121 - 1190
AAMPNSASRDEFPCGFTSPANRGSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTR   1191 - 1260
QSSTRSSVSQYNRLDQYEIRSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKR   1261 - 1330
NIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNT   1331 - 1400
ATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSA   1401 - 1470
FFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVA   1471 - 1540
LSGGSRFQESLFIINNFANSDRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKS   1541 - 1610
YASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNIDEEGAMK   1611 - 1680
EDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYRTLHGAYTKIL   1681 - 1750
EVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDK   1751 - 1820
VNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVFEAPYTLSGKKQGCIEEQCKRRTILT   1821 - 1890
TSNSFPYVKKRIPINCEQQINLKPIDVATDEIKDKTAELQKLCSSTDVDMIQLQLKLQGCVSVQVNAGPL   1891 - 1960
AYARAFLNDSQASKYPPKKVSELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDI   1961 - 2030
IHEQILQEDTMHSPWMSNTLHVFCAISGTSSDRGYGSPRYAEV                              2031 - 2073
//

Text Mined References (14)

PMID Year Title