Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.58
PubTator Score 8.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 0.016
osteosarcoma -2.686 0.000
tuberculosis 1.400 0.000
ovarian cancer 2.300 0.000

AA Sequence

MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGD      1 - 70
TSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF                      71 - 123
//

Text Mined References (7)

PMID Year Title
17707236 2007 20S proteasome assembly is orchestrated by two distinct pairs of chaperones in yeast and in mammals.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.