Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.23
PubTator Score 0.06

Knowledge Summary

Patent (122)

Gene RIF (4)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19372141 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPKLNSTFVTEFLFEGFSSFRRQHKLVFFVVFLTLYLLTLSGNVIIMTIIRLDHHLHTPMYFFLCMLSIS      1 - 70
ETCYTVAIIPHMLSGLLNPHQPIATQSCATQLFFYLTFGINNCFLLTVMGYDRYVAICNPLRYSVIMGKR     71 - 140
ACIQLASGSLGIGLGMAIVQVTSVFGLPFCDAFVISHFFCDVRHLLKLACTDTTVNEIINFVVSVCVLVL    141 - 210
PMGLVFISYVLIISTILKIASAEGQKKAFATCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYT    211 - 280
HHSPTEPCCVQPEEQGGQRCSAQSRGAKNSVSLMKRGCEGFSFAFINMY                         281 - 329
//

Text Mined References (11)

PMID Year Title
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.
More...