Property Summary

NCBI Gene PubMed Count 2
PubMed Score 4.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cognitive disorder 44 1.0

Gene RIF (1)

PMID Text
24709545 The SGPX gene is a putative novel cancer biomarker. [Meta-analysis]

AA Sequence

MNLVICVLLLSIWKNNCMTTNQTNGSSTTGDKPVESMQTKLNYLRRNLLILVGIIIMVFVFICFCYLHYN      1 - 70
CLSDDASKAGMVKKKGIAAKSSKTSFSEAKTASQCSPETQPMLSTADKSSDSSSPERASAQSSTEKLIRP     71 - 140
SSLQKPSIPNSAGKLTRPSYPKRSSKSSCSKKLSKSSHLEKAHKKGSLEKLCKLDYACKLASSDKPVRPP    141 - 210
QLFKPLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAETCQPYKKKHLVAKTYR    211 - 280
PLVNDISEAKEKNTQNLHVSSKVKSSSRSFRKLDSRNNAYGDHVNDSDTMKYYSEVDSDKVIIITCDRGY    281 - 350
NQVTSEVTLND                                                               351 - 361
//

Text Mined References (4)

PMID Year Title
24709545 A novel transmembrane glycoprotein cancer biomarker present in the X chromosome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.