Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.50

Knowledge Summary

Patent (72)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 105 3.15 1.6

Synonym

Accession Q5JQS5 B2RP03
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid

AA Sequence

MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLHSPMYIFLSHL      1 - 70
SFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLAAMALDRYVAICKPLHYAVLM     71 - 140
HRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNNFFCEVPAVIKLSCADTAVNDTILAVLVAFF    141 - 210
VLVPLALILLSYGFIARAVLRIQSSKGRHKAFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISL    211 - 280
FYSIITPTLNPFTYTLRNKDMKGALRRLLARIWRLCG                                     281 - 317
//

Text Mined References (5)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
19098911 2009 Common variants in the NLRP3 region contribute to Crohn's disease susceptibility.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.