Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.50

Knowledge Summary

Patent (72)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 111 3.159 1.6

AA Sequence

MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLHSPMYIFLSHL      1 - 70
SFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLAAMALDRYVAICKPLHYAVLM     71 - 140
HRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNNFFCEVPAVIKLSCADTAVNDTILAVLVAFF    141 - 210
VLVPLALILLSYGFIARAVLRIQSSKGRHKAFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISL    211 - 280
FYSIITPTLNPFTYTLRNKDMKGALRRLLARIWRLCG                                     281 - 317
//

Text Mined References (5)

PMID Year Title