Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.69
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 5.6e-04
atypical teratoid / rhabdoid tumor -1.300 2.0e-04
glioblastoma -1.200 1.3e-03
medulloblastoma, large-cell -1.500 7.4e-04
osteosarcoma -2.306 5.9e-06
pituitary cancer 1.100 6.7e-03

Gene RIF (1)

AA Sequence

MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIR      1 - 70
WMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNL     71 - 140
STQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFLITSCNWTKEELLNEFSEGWSTV    141 - 210
AGFWLTAALTSWAQAIFSTSASRVGGTTGTHHHAWIIFVFLAETRFCHVVQAGLELLGSSDSPTWPPKVL    211 - 280
GLYHARPSLAF                                                               281 - 291
//

Text Mined References (11)

PMID Year Title