Property Summary

NCBI Gene PubMed Count 13
PubMed Score 243.29
PubTator Score 36.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

AA Sequence

MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGS      1 - 70
FILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPC     71 - 140
FCSPQRLELLKKEALRNHQTPRYDNRCRNMSQEQVAQKLAKDPKPAIRFRLEQVVPAFQDLVYGWNRHEV    141 - 210
ASVEGDPVIMKSDGFPTYHLACVVDDHHMGISHVLRGSEWLVSTAKHLLLYQALGWQPPHFAHLPLLLNR    211 - 280
DGSKLSKRQGDVFLEHFAADGFLPDSLLDIITNCGSGFAENQMGRTLPELITQFNLTQVTCHSALLDLEK    281 - 350
LPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPV    351 - 420
YSYLWTRPAVGRAQLDAISEKVDVIAKRVLGLLERSSMSLTQDMLNGELKKLSEGLEGTKYSNVMKLLRM    421 - 490
ALSGQQQGPPVAEMMLALGPKEVRERIQKVVSS                                         491 - 523
//

Text Mined References (19)

PMID Year Title