Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.100 9.5e-03
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
medulloblastoma, large-cell -1.200 5.1e-03
osteosarcoma -1.412 1.6e-04
ovarian cancer -1.100 3.0e-03
primary pancreatic ductal adenocarcinoma 1.068 3.7e-03
Rheumatoid arthritis 1.900 3.4e-05

Synonym

Accession Q5HYC2 A8MTP2 B9EGW7 Q4VXA2 Q8IVE5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (3)

AA Sequence

MSVPGTPGAMEPAGEEERPPPAAEGEDDEEEVAAAAQTSGPAHGRSASSLEDADDQEEEMEAMVIGGGCC      1 - 70
KEQELTYELQQGYRILGEFLQEKHRGLTAPFLQPLGGVATAEEEVAEGPRSGGRGGRAFPQQPGQGMCLL     71 - 140
QMEEKFASGQYGGITEFVADFRLMLETCYRLHGVDHWISKQGQKLEMMLEQKLALLSRHLREKTTIAVTS    141 - 210
RGYYGLEDEKGTACTSTRRRSTPRSLAGLTSGVFESIMVQVLRQEEQLRAKEEKRLREQERKEAEEASQK    211 - 280
EIEEWERKLLAQAAPTCMETMWEIPAIGHFLCLAQQILNLPEIVFYELERCLLMPQCNAFLSKIMTSLLS    281 - 350
PPHRRPTLHRRPTLPYRTWEAALRQKVQQWYTAVGQTENPDNCAEKLGLCPQFFKVLGEVNPLEEKPFHE    351 - 420
LPFYQKVWLLKGLCDFVYETQKEVQDAVLGQPIHECREVILGYDYLENAYVHFPQFCGADVRIYKQRPFQ    421 - 490
APEFPIPPIKIQRVPRIKLEKLKCDYVSTSNGEHRCSRDSLPSSFKKEQENNFDPACCPAKMILDNHDIS    491 - 560
VEMGVKSNYEIRIRRPCEIKKTDCCKENLEKPRSPGEVTGFGEPLSPGEIRFIENQEKYGEASRIKIEPS    561 - 630
PLKENTLKSCQIHVNGSHSDHPEINCHKVVRDILLEQSLQSHKKLKLTKMRAKKKKKKKKKLKDVLNENL    631 - 700
QRKREGLHSLAFKSYKPEIQNKLLIIKKKAKHKKHKSGKKSVSKKAITKKRKTVIKSPTVPEFQLICTNL    701 - 770
DELRELITKIENELKDLENSRKKSGKWYHRRQAVKELHSTLIRLLNELLPWEPKLMKAFQRNRSRLKKDY    771 - 840
DDFRRQPDHDTFNRELWTTDEGEGDLGKDSPKGEISKSIDSTEPLDILEKDHFDSDDMKLSEIDFPMARS    841 - 910
KLLKKELPSKDLPKTLLKTLKRQSKQTDYVDDSTKELSPRKKAKLSTNETTVENLESDVQIDCFSESKHT    911 - 980
EPSFPESFASLDSVPVSTLQKGTKPIQALLAKNIGNKVTLTNQLPPSTGRNALAVEKPVLSPPEASPIKP    981 - 1050
ALTCHTNTKGPLQMVYKMPCGQWLPIDLQNSSVKIQVQPMVDPKTGEKIMQQVLILPKNFVIQHKEGKAV   1051 - 1120
AKEVPPLQQKGTEQHCSSFPQTTNINSSLASVFVNSPGTVSTQLPNTAFNKTITPLSNISSARPQPLSPV   1121 - 1190
TSVSNLLTPSVKTSQSEAGKAKNAVSAATFSLPSASPTISSTGQPLSSTTTLNGSTNPGSSFNCFAQQTA   1191 - 1260
DSSEAKQELKTVCIRDSQSILVRTRGGNTGVVKVQTNPDQNSPNTVSSSSVFTFAPQLQAFLVPKSTTSS   1261 - 1330
SAFSPVAGTTTTSSLSPFSQTPTSVSIPASFAPSMGKNLKLTLGHTTGSGDLGHVIDKTSHMPSSPLKSS   1331 - 1400
ICSSTLLPSTTSSSVSVISISAANFGQNNANIIHTPTKQQQVDYITKSYPVTRSEATAATNGDVISGTPV   1401 - 1470
QKLMLVSAPSILSSGNGTAINMTPALTSTGVSAQKLVFINAPVPSGTSTPTLVAESLKQTLPPPLHKAYV   1471 - 1540
KTPEQPQIVLIPSTVGTPIKINSSPAVSQIKDVKIGLNIGQAIVNTSGTVPAIPSINILQNVTPKGEDKS   1541 - 1610
SKGYILPLSTSGNSVPVSSNFVSQNITPVNESVVSSARAVNVLSVTGANLSLGSFPVTSASASAGAQPPV   1611 - 1680
LVSGNDTSSRIMPILSNRLCSSSLGNTVAISTVKTGHLASSVLISTTQPVVSPKCLTSALQIPVTVALPT   1681 - 1750
PATTSPKIINTVPHSAAVPGATRSVSISKRQSRTSLQFHSPGISTTVPTNVNTNKPQTELSSLSTSPGKI   1751 - 1820
TNTSNFASLPNQQALVKTPSYSSAPGGTTIHTASAPSNVTSLVGSQFSEPCIQQKIVINTSTPLAPGTQI   1821 - 1890
MINGTRFIVPPQGLGAGSHVLLISTNPKYGAPLVLNSGQGIQSTPIDNSAQKITLASNNSLSGQPLQHPL   1891 - 1960
RSPTKFINSFGNASSIPTVHTSPQLINTTAKVPVPPPVPTVSLTSVIKSPATLLAKTSLVSAICPSNPPL   1961 - 2030
PSSTSVFHLDPPVKKLLVSPEGAILNTINTPASKVSSLSPSLSQIVVSASRSPASVFPAFQSSGLEKPDR   2031 - 2100
AAS                                                                      2101 - 2103
//

Text Mined References (6)

PMID Year Title