Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.53
PubTator Score 19.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 6.1e-08
Breast cancer 6.100 2.2e-02
ependymoma 1.100 6.4e-07
glioblastoma 1.400 2.4e-08
group 4 medulloblastoma 1.400 6.7e-05
invasive ductal carcinoma 1.100 1.0e-02
lung cancer 1.800 1.5e-04
medulloblastoma, large-cell 2.000 2.9e-06
non primary Sjogren syndrome sicca -1.100 1.7e-02
ovarian cancer -1.400 2.6e-07
pediatric high grade glioma 1.500 5.5e-06
Pick disease -1.300 3.0e-05
primitive neuroectodermal tumor 1.500 7.3e-05
progressive supranuclear palsy -1.200 3.9e-02

Gene RIF (9)

AA Sequence

MGPTRKPNVCSRLSRRALGCFSRDAGVVQRTNLGILRALVCQESTKFKNVWTTHSRSPIAYERGRIYFDN      1 - 70
YRRCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPNSSDYKSSLIALTAHNWLLRISATTGKI     71 - 140
LEKIYLAPYCKFRYLSWDTPQEVIAVKSAQNRGSAVARQAGIQQHVLLYLAVFRVLPFSLVGILEINKKI    141 - 210
FGNVTDATLSHGILIVMYSSGLVRLYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITD    211 - 280
MPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEMDCCSLESDWIYFHPD    281 - 350
ASGRIIHVGPNQVKVLKLTEIENNSSQHQISEDFVILANRENHKNENVLTVTASGRVVKKSFNLLDDDPE    351 - 420
QETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHI    421 - 490
EQKPNRVFSCYVYQMICDTGEEEETINRSC                                            491 - 520
//

Text Mined References (18)

PMID Year Title