Property Summary

NCBI Gene PubMed Count 22
PubMed Score 109.63
PubTator Score 71.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.165 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.3e-02
osteosarcoma -1.170 3.9e-06
ovarian cancer 1.400 3.9e-03
psoriasis -1.500 1.1e-04

Synonym

Accession Q5H9R7 Q3B7I1 Q3I4Y0 Q3KR35 Q68CR3 Q7L4R8 Q8N3B2 Q96MB2 Q9H2K5 Q9H2K6 Q9HCL4 Q9NUY3
Symbols SAPL
PP6R3
SAPLa
SAPS3
SAP190
C11orf23

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMD      1 - 70
EKIRYKYPNISCELLTSDVSQMNDRLGEDESLLMKLYSFLLNDSPLNPLLASFFSKVLSILISRKPEQIV     71 - 140
DFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLNWLNEEKIIQRLVEIVHPSQEEDRHSN    141 - 210
ASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRR    211 - 280
PTFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGVLDPPVGNTRLNVIRL    281 - 350
ISSLLQTNTSSINGDLMELNSIGVILNMFFKYTWNNFLHTQVEICIALILASPFENTENATITDQDSTGD    351 - 420
NLLLKHLFQKCQLIERILEAWEMNEKKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSALVQQLIKDLPD    421 - 490
EVRERWETFCTSSLGETNKRNTVDLVTTCHIHSSSDDEIDFKETGFSQDSSLQQAFSDYQMQQMTSNFID    491 - 560
QFGFNDEKFADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAF    561 - 630
TPESQRRSSSGSTDSEESTDSEEEDGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLD    631 - 700
SVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEPMDPLTPSAAALAVQPEAAGS    701 - 770
VAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTETAVFKSEEGKLSTSQDAACKDAEECPETA    771 - 840
EAKCAAPRPPSSSPEQRTGQPSAPGDTSVNGPV                                         841 - 873
//

Text Mined References (33)

PMID Year Title