Property Summary

NCBI Gene PubMed Count 22
PubMed Score 109.63
PubTator Score 71.06

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.165 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.3e-02
osteosarcoma -1.170 3.9e-06
ovarian cancer 1.400 3.9e-03
psoriasis -1.500 1.1e-04

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMD      1 - 70
EKIRYKYPNISCELLTSDVSQMNDRLGEDESLLMKLYSFLLNDSPLNPLLASFFSKVLSILISRKPEQIV     71 - 140
DFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLNWLNEEKIIQRLVEIVHPSQEEDRHSN    141 - 210
ASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRR    211 - 280
PTFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGVLDPPVGNTRLNVIRL    281 - 350
ISSLLQTNTSSINGDLMELNSIGVILNMFFKYTWNNFLHTQVEICIALILASPFENTENATITDQDSTGD    351 - 420
NLLLKHLFQKCQLIERILEAWEMNEKKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSALVQQLIKDLPD    421 - 490
EVRERWETFCTSSLGETNKRNTVDLVTTCHIHSSSDDEIDFKETGFSQDSSLQQAFSDYQMQQMTSNFID    491 - 560
QFGFNDEKFADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAF    561 - 630
TPESQRRSSSGSTDSEESTDSEEEDGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLD    631 - 700
SVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEPMDPLTPSAAALAVQPEAAGS    701 - 770
VAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTETAVFKSEEGKLSTSQDAACKDAEECPETA    771 - 840
EAKCAAPRPPSSSPEQRTGQPSAPGDTSVNGPV                                         841 - 873
//

Text Mined References (33)

PMID Year Title