Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.65466781974151E-21
lung carcinoma 2844 8.6428078970382E-15
juvenile dermatomyositis 1189 1.57056000778452E-8
Breast cancer 3099 4.78312829975337E-8
osteosarcoma 7933 1.32299605273033E-7
acute quadriplegic myopathy 1157 4.26469213669858E-7
posterior fossa group B ependymoma 1530 9.98570794609536E-7
invasive ductal carcinoma 2950 4.68666872816989E-4
glioblastoma 5572 5.11854836889267E-4
astrocytic glioma 2241 0.00457711944544506
subependymal giant cell astrocytoma 2287 0.00518644360101295
atypical teratoid / rhabdoid tumor 4369 0.00631555332430144
medulloblastoma, large-cell 6234 0.00642425467348529
oligodendroglioma 2849 0.0093028471966655
adult high grade glioma 2148 0.0119670907156753
medulloblastoma 1524 0.0129996320190076

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 2.000 0.005
oligodendroglioma 1.900 0.009
osteosarcoma 1.968 0.000
posterior fossa group B ependymoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.400 0.006
glioblastoma -1.600 0.001
medulloblastoma -1.100 0.013
medulloblastoma, large-cell -1.800 0.006
juvenile dermatomyositis 1.077 0.000
acute quadriplegic myopathy 1.793 0.000
adult high grade glioma -1.100 0.012
subependymal giant cell astrocytoma -1.636 0.005
lung carcinoma 1.100 0.000
Breast cancer -2.100 0.000
invasive ductal carcinoma -1.500 0.000
ovarian cancer -3.100 0.000

Synonym

Accession Q5H9R4 A8K928 B3KXA4 Q5H9K8 Q8N8D6
Symbols GASP4
CXorf35

Gene

  Ortholog (2)

Species Source
Mouse OMA EggNOG
Rat OMA EggNOG

AA Sequence

MSAAGLKITGSKETKRRLLLISIDWSRDLMNLCIYFRVYCQEKQEERRELPRIITGPPPEAAVVAFEWLK      1 - 70
TSTLTGLHPQLPLSLPQPECALPYLVRAFSRGDYMGRIQEVGWVTAGLVIWAGTCYYIYKFTKGRAQSVR     71 - 140
TLARNGSTVKMETVVGVQSQTLAINEAEIKTKPQVEIGAETGARSGPRAEVETKATAIAIHRANSQAKAM    141 - 210
VGAEPETQSESKVVAGTLVMTEAVTLTEVKAKAREVAMKEAVTQTDAEAGKIVKKEAVTQTKAKAWALVA    211 - 280
KTEAKREAMTQTKAETHILAEKETEINRVMVTQSETLAVPREVAKMGATNKTGIVDETKTRALEETVLIP    281 - 350
RAFPSKNASC                                                                351 - 360
//

Text Mined References (10)

PMID Year Title
22569362 2012 The Eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
9770300 1999 The armadillo family of structural proteins.
7907279 1994 A repeating amino acid motif shared by proteins with diverse cellular roles.