Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.83
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.700 2.8e-02
Breast cancer -1.100 2.7e-03
chronic rhinosinusitis -1.455 3.4e-03
ependymoma 1.700 1.3e-02
intraductal papillary-mucinous carcinoma... -1.900 3.9e-03
medulloblastoma, large-cell -1.500 1.5e-03
nasopharyngeal carcinoma -1.100 2.4e-02
non diabetic and post-ischemic heart fai... 1.200 1.4e-02
non-small cell lung cancer -1.245 1.2e-17
osteosarcoma -3.840 3.9e-05
ovarian cancer -2.600 2.8e-05
Pick disease -1.700 1.0e-05
progressive supranuclear palsy -1.900 5.3e-03
tuberculosis 1.400 9.1e-05

Gene RIF (1)

AA Sequence

MESCSVTRLECSGAISAHCSLHLPGSSDSPASASQIAGTTDAIWNEQEKAELFTDKFCQVCGVMLQFESQ      1 - 70
RISHYEGEKHAQNVSFYFQMHGEQNEVPGKKMKMHVENFQVHRYEGVDKNKFCDLCNMMFSSPLIAQSHY     71 - 140
VGKVHAKKLKQLMEEHDQASPSGFQPEMAFSMRTYVCHICSIAFTSLDMFRSHMQGSEHQIKESIVINLV    141 - 210
KNSRKTQDSYQNECADYINVQKARGLEAKTCFRKMEESSLETRRYREVVDSRPRHRMFEQRLPFETFRTY    211 - 280
AAPYNISQAMEKQLPHSKKTYDSFQDELEDYIKVQKARGLDPKTCFRKMRENSVDTHGYREMVDSGPRSR    281 - 350
MCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGLEPKTCFRKIGDS    351 - 420
SVETHRNREMVDVRPRHRMLEQKLPCETFQTYSGPYSISQVVENQLPHCLPAHDSKQRLDSISYCQLTRD    421 - 490
CFPEKPVPLSLNQQENNSGSYSVESEVYKHLSSENNTADHQAGHKQKHQKRKRHLEEGKERPEKEQSKHK    491 - 560
RKKSYEDTDLDKDKSIRQRKREEDRVKVSSGKLKHRKKKKSHDVPSEKEERKHRKEKKKSVEERTEEEML    561 - 630
WDESILGF                                                                  631 - 638
//

Text Mined References (13)

PMID Year Title