Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.83
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.19050150766059E-17
Pick disease 1893 1.01585621967486E-5
tuberculosis and treatment for 3 months 327 1.24945673280048E-5
ovarian cancer 8492 2.8287016368129E-5
osteosarcoma 7933 3.85575143297395E-5
medulloblastoma, large-cell 6234 0.00145432362017181
Breast cancer 3099 0.00270545811946757
chronic rhinosinusitis 512 0.00336787245993097
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0038507681320549
progressive supranuclear palsy 674 0.00527147586347452
ependymoma 2514 0.0128858189092826
non diabetic and post-ischemic heart failure 200 0.0138741214506787
nasopharyngeal carcinoma 1056 0.0240688238563148
astrocytic glioma 2241 0.0281749645907778

Expression

Synonym

Accession Q5H9K5 Q8NDS3 Q96JN6
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Gene RIF (1)

PMID Text
26191264 Suggest that ZMAT1 transcript variant 2 is a potential diagnostic factor in patients with gastric cancer.

AA Sequence

MESCSVTRLECSGAISAHCSLHLPGSSDSPASASQIAGTTDAIWNEQEKAELFTDKFCQVCGVMLQFESQ      1 - 70
RISHYEGEKHAQNVSFYFQMHGEQNEVPGKKMKMHVENFQVHRYEGVDKNKFCDLCNMMFSSPLIAQSHY     71 - 140
VGKVHAKKLKQLMEEHDQASPSGFQPEMAFSMRTYVCHICSIAFTSLDMFRSHMQGSEHQIKESIVINLV    141 - 210
KNSRKTQDSYQNECADYINVQKARGLEAKTCFRKMEESSLETRRYREVVDSRPRHRMFEQRLPFETFRTY    211 - 280
AAPYNISQAMEKQLPHSKKTYDSFQDELEDYIKVQKARGLDPKTCFRKMRENSVDTHGYREMVDSGPRSR    281 - 350
MCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGLEPKTCFRKIGDS    351 - 420
SVETHRNREMVDVRPRHRMLEQKLPCETFQTYSGPYSISQVVENQLPHCLPAHDSKQRLDSISYCQLTRD    421 - 490
CFPEKPVPLSLNQQENNSGSYSVESEVYKHLSSENNTADHQAGHKQKHQKRKRHLEEGKERPEKEQSKHK    491 - 560
RKKSYEDTDLDKDKSIRQRKREEDRVKVSSGKLKHRKKKKSHDVPSEKEERKHRKEKKKSVEERTEEEML    561 - 630
WDESILGF                                                                  631 - 638
//

Text Mined References (13)

PMID Year Title
26191264 2015 Downregulation of long noncoding RNA ZMAT1 transcript variant 2 predicts a poor prognosis in patients with gastric cancer.
18253864 2008 Keep your fingers off my DNA: protein-protein interactions mediated by C2H2 zinc finger domains.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15718139 2005 Zinc finger proteins: getting a grip on RNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11361095 2001 Three classes of C2H2 zinc finger proteins.
More...