Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.65
PubTator Score 10.39

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
malignant mesothelioma 3163 3.07852993828482E-7
lung adenocarcinoma 2714 6.64041564542833E-7
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Ossifying fibromyxoid tumor 6 3.592 1.8
acute myeloid leukemia 785 3.329 1.7


  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
lung adenocarcinoma 1.100 0.000


Accession Q5H9F3 B5MDQ8 Q5H9F2 Q5H9F4 Q6ZVE0 Q8TEN3 Q9Y528 BCoR-L1
Symbols BCoR-L1




  Ortholog (12)

Gene RIF (7)

26879601 Studied the clinical significance of BCORL1 and its role in the metastasis of HCC.
26648304 BCORL1 knockdown up-regulates E-cadherin expression and subsequently inhibits cell migration and invasion of lung cancer cells.
25596268 study concluded that in pediatric acute myeloid leukemia, BCOR and BCORL1 mutations rarely occur
24047651 Data indicate that sequencing of BCOR and related BCORL1 genes in a cohort of 354 myelodysplastic syndromes (MDS) patients identified 4.2% and 0.8% of mutations respectively.
23793880 genetic association study in population in Italy: Data suggest BCORL1 mutations/single nucleotide polymorphisms are not associated with leukemic transformation of chronic myeloproliferative neoplasms (MPN) into acute myeloid leukemia (AML). [LETTER]
21989985 BCORL1 by genetic criteria is a novel candidate tumor suppressor gene, joining the growing list of genes recurrently mutated in acute myelogenous leukemia.
17697391 Dysregulated BCoR-L1 expression is associated with breast cancer

AA Sequence

PGSSETVELVRYEPDLLRLLGSEVEFQSCNS                                          1681 - 1711

Text Mined References (24)

PMID Year Title
26879601 2016 BCORL1 is an independent prognostic marker and contributes to cell migration and invasion in human hepatocellular carcinoma.
26648304 2015 [Expression and clinical significance of BCL6 corepressor-like 1 in non-small cell lung cancer].
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25596268 2015 BCOR and BCORL1 mutations in pediatric acute myeloid leukemia.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24123876 2013 Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.
24047651 2013 BCOR and BCORL1 mutations in myelodysplastic syndromes and related disorders.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23793880 2014 Mutational analysis of BCORL1 in the leukemic transformation of chronic myeloproliferative neoplasms.