Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.97
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (2)

PMID Text
20560530 Observational study of genetic testing. (HuGE Navigator)
16431037 XPLAC is expressed mostly in placenta and adrenal gland while XTES is exclusively expressed in primate testis

AA Sequence

METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYCGEVAFGLYMFEIYRKANDTFWMSFT      1 - 70
ISFIIVGAILDQIILMFFNKDLRRNKAALLFWHILLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITK     71 - 140
RNTMLEREIAFSIRDNFMQQKAFKYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYG    141 - 210
AIRCNILAIQISNDDTTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPW    211 - 280
LEFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQRWGHRILHYSF    281 - 350
QFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQYLYPWQSGKVLPGRTENQPEAP    351 - 420
YYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTCS                                   421 - 459
//

Text Mined References (8)

PMID Year Title
25120641 2014 NUP214 fusion genes in acute leukemia (Review).
20560530 2010 Robust, high-throughput solution for blood group genotyping.
19835606 2009 Targeted next-generation sequencing of a cancer transcriptome enhances detection of sequence variants and novel fusion transcripts.
16431037 2006 Identification of two new members, XPLAC and XTES, of the XK family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.