Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.97
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (2)

AA Sequence

METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYCGEVAFGLYMFEIYRKANDTFWMSFT      1 - 70
ISFIIVGAILDQIILMFFNKDLRRNKAALLFWHILLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITK     71 - 140
RNTMLEREIAFSIRDNFMQQKAFKYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYG    141 - 210
AIRCNILAIQISNDDTTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPW    211 - 280
LEFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQRWGHRILHYSF    281 - 350
QFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQYLYPWQSGKVLPGRTENQPEAP    351 - 420
YYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTCS                                   421 - 459
//

Text Mined References (8)

PMID Year Title