Property Summary

NCBI Gene PubMed Count 10
PubMed Score 88.56
PubTator Score 63.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.197 0.001
cystic fibrosis 1.100 0.002

Synonym

Accession Q5FYB1 A1L3B0 B3KV22 B7XD03 ASI
Symbols ASI
SPG66

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
19262745 No mutation was found in the ARSI gene locus of the retinitis pigmentosa patients examined.
16500042 The identification, molecular cloning and initial characterization of three new members of this human gene family is reported.

AA Sequence

MHTLTGFSLVSLLSFGYLSWDWAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIE      1 - 70
TPTLDRLAAKGVKLENYYIQPICTPSRSQLLTGRYQIHTGLQHSIIRPQQPNCLPLDQVTLPQKLQEAGY     71 - 140
STHMVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGENVAWGLSGQYSTM    141 - 210
LYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVARRKYAAMVTCMDEAVRNITWA    211 - 280
LKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRGLGFVHSPLLKRKQRTSRALMHITDW    281 - 350
YPTLVGLAGGTTSAADGLDGYDVWPAISEGRASPRTEILHNIDPLYNHAQHGSLEGGFGIWNTAVQAAIR    351 - 420
VGEWKLLTGDPGYGDWIPPQTLATFPGSWWNLERMASVRQAVWLFNISADPYEREDLAGQRPDVVRTLLA    421 - 490
RLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEEEEEGRARSFSRGRRKKKCKICKLRSFFRKL    491 - 560
NTRLMSQRI                                                                 561 - 569
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
19262745 2009 Characterization of the arylsulfatase I (ARSI) gene preferentially expressed in the human retinal pigment epithelium cell line ARPE-19.
16500042 2006 Molecular cloning and initial characterization of three novel human sulfatases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16174644 2005 Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...