Property Summary

NCBI Gene PubMed Count 1
Grant Count 96
R01 Count 57
Funding $8,741,170.1
PubMed Score 119.08
PubTator Score 564.71

Knowledge Summary

Patent

No data available

Synonym

Accession Q5FYA8 ASH
Symbols sulfatase

Gene

PANTHER Protein Class (1)

AA Sequence

MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRAAFLTGRYPIR      1 - 70
SGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGLSCASRNDHCYHPLNHGFHYF     71 - 140
YGVPFGLLSDCQASKTPELHRWLRIKLWISTVALALVPFLLLIPKFARWFSVPWKVIFVFALLAFLFFTS    141 - 210
WYSSYGFTRRWNCILMRNHEIIQQPMKEEKVASLMLKEALAFIERYKREPFLLFFSFLHVHTPLISKKKF    211 - 280
VGRSKYGRYGDNVEEMDWMVGKILDALDQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGM    281 - 350
GGWEGGIRVPGIFRWPSVLEAGRVINEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDH    351 - 420
EFLFHYCGVYLHTVRWHQKDCATVWKAHYVTPKFYPEGTGACYGSGICSCSGDVTYHDPPLLFDISRDPS    421 - 490
EALPLNPDNEPLFDSVIKKMEAAIREHRRTLTPVPQQFSVFNTIWKPWLQPCCGTFPFCGCDKEDDILPM    491 - 560
AP                                                                        561 - 562
//

Text Mined References (1)

PMID Year Title
16174644 2005 Sulfatases and sulfatase modifying factors: an exclusive and promiscuous relationship.