Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.75
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

Synonym

Accession Q5FWF7
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of F-box protein 48 (FBXO48) in human primary T cells
23485738 mutations in the coding region of the FBXO48 gene play little or no role in the development of Parkinson diseases.

AA Sequence

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIR      1 - 70
NSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPM     71 - 140
DADTWGEILEAELER                                                           141 - 155
//

Publication (4)

PMID Year Title
23485738 2013 Genetic analysis of the FBXO48 gene in Chinese Han patients with Parkinson disease.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.