Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.67
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
early-onset Parkinson disease 2 5.034 2.5

Expression

Gene RIF (2)

AA Sequence

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIR      1 - 70
NSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPM     71 - 140
DADTWGEILEAELER                                                           141 - 155
//

Text Mined References (4)

PMID Year Title