Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.24158453651292E-10
osteosarcoma 7933 2.39447657597857E-8
cystic fibrosis 1670 2.62385278223266E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.80178379098842E-4
medulloblastoma, large-cell 6234 7.8499508406821E-4
group 3 medulloblastoma 2254 9.46230521751431E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00176368294823236
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0233010939493105

Expression

Synonym

Accession Q5FWF6 A4D282 A6NH61 Q6ZMZ9
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 GWAS Trait (1)

AA Sequence

MFPPARGKELLSFEDVAMYFTREEWGHLNWGQKDLYRDVMLENYRNMVLLGFQFPKPEMICQLENWDEQW      1 - 70
ILDLPRTGNRKASGSACPGSEARHKMKKLTPKQKFSEDLESYKISVVMQESAEKLSEKLHKCKEFVDSCR     71 - 140
LTFPTSGDEYSRGFLQNLNLIQDQNAQTRWKQGRYDEDGKPFNQRSLLLGHERILTRAKSYECSECGKVI    141 - 210
RRKAWFDQHQRIHFLENPFECKVCGQAFRQRSALTVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHT    211 - 280
KEKPYKCSKCEKTFSQNSTLIRHQVIHSGEKRHKCLECGKAFGRHSTLLCHQQIHSKPNTHKCSECGQSF    281 - 350
GRNVDLIQHQRIHTKEEFFQCGECGKTFSFKRNLFRHQVIHTGSQPYQCVICGKSFKWHTSFIKHQGTHK    351 - 420
GQIST                                                                     421 - 425
//

Text Mined References (6)

PMID Year Title
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.