Property Summary

NCBI Gene PubMed Count 17
Grant Count 13
R01 Count 4
Funding $936,478
PubMed Score 38.67
PubTator Score 21.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26305936 Data show that acetyltransferase Esco1 colocalizes with cohesin throughout the cell cycle and down-regulates expression of neighboring genes.
26051894 By interacting with a unique domain of Esco1, Pds5 recruits Esco1 to chromatin-bound cohesin complexes to form cohesion.
23755103 This is the first report of somatic mutations within ESCO1 and CHTF18 in endometrial tumors and of MRE11A mutations in microsatellite-stable endometrial tumors.
20331966 this is the first evidence that Eco1 represses transcription by interacting with histone demethylase, LSD1 to convert chromatin to inactive state.
19861517 Variants in ESCO1 is associated with predisposition for TMPRSS2-ERG fusion in prostate cancer.
19861517 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18614053 This study identified a molecular target for the acetyltransferase Eco1 and revealed that Smc3 acetylation is a conserved mechanism in regulating sister chromatid cohesion.
15958495 EFO1 and EFO2 are targeted to different chromosome structures to help establish or maintain sister-chromatid cohesion
14576321 identification of the first full-length human ortholog of yeast Ctf7p and characterization of its enzymatic activity, localization and novel genetic composition

AA Sequence

MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQPELETRMSTRS      1 - 70
SKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNRRSQRLQQLTEVSRRSLRSRE     71 - 140
IQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVLEVKSDSKEDENLVINEVINSPKGKKRKVEH    141 - 210
QTACACSSQCTQGSEKCPQKTTRRDETKPVPVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSP    211 - 280
QPSVPEQSDNELEQAGKSKRGSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQI    281 - 350
LHQKETNQDVQCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT    351 - 420
SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAPENCHLANEIK    421 - 490
PSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKIDTGENKFPGSAPQQHSILSN    491 - 560
QTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKTDEKQLIIDAGQKRFGAVSCNVCGMLYTASN    561 - 630
PEDETQHLLFHNQFISAVKYVGWKKERILAEYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPL    631 - 700
MCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGIS    701 - 770
RIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST    771 - 840
//

Publication (22)

PMID Year Title
26547586 2016 Increased expression of ESCO1 is correlated with poor patient survival and its role in human bladder cancer.
26305936 2015 Cohesin recruits the Esco1 acetyltransferase genome wide to repress transcription and promote cohesion in somatic cells.
26051894 2015 Esco1 Acetylates Cohesin via a Mechanism Different from That of Esco2.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
23755103 2014 Sequencing of candidate chromosome instability genes in endometrial cancers reveals somatic mutations in ESCO1, CHTF18, and MRE11A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21111234 2010 Sororin mediates sister chromatid cohesion by antagonizing Wapl.
20331966 2010 Cohesion establishment factor, Eco1 represses transcription via association with histone demethylase, LSD1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19907496 2009 Cohesin acetylation speeds the replication fork.
More...