Property Summary

NCBI Gene PubMed Count 12
Grant Count 289
R01 Count 82
Funding $99,415,351.74
PubMed Score 330.56
PubTator Score 2.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.300 0.039
tuberculosis 2.000 0.000
non-small cell lung cancer -1.918 0.000
active Crohn's disease 1.440 0.002
adult high grade glioma 2.500 0.000
group 3 medulloblastoma -1.700 0.002
subependymal giant cell astrocytoma 2.925 0.008
invasive ductal carcinoma 1.071 0.015
lung carcinoma -2.000 0.000
ulcerative colitis 1.800 0.000
ovarian cancer 1.100 0.018

Synonym

Accession Q5EG05 Q96RJ9
Symbols COP
COP1
PSEUDO-ICE

Gene

Gene RIF (6)

PMID Text
26521743 Expression of NOX4/p22(phox) as well as ROS production is enhanced by IL-1beta. On the other hand, the use of NOX4 inhibitors decreased IL-1beta-induced collagenase synthesis by chondrocytes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of caspase recruitment domain family, member 16 (CARD16; COP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16920334 Cop inhibition of cell death, at least to a certain extent, results from its interference with the activation of caspase-1 and caspase-4.
16354923 Caspase-1-mediated cell death is regulated, at least in part, by the balance of Rip2 and Cop; alterations of this balance may contribute to aberrant caspase-1-mediated pathogenesis in Huntington's disease.

AA Sequence

MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ      1 - 70
ICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKW     71 - 140
SERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS                 141 - 197
//

Text Mined References (14)

PMID Year Title
26521743 2015 IL-1beta mediates MMP secretion and IL-1beta neosynthesis via upregulation of p22(phox) and NOX4 activity in human articular chondrocytes.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20479761 2011 Altered expression of genes involved in inflammation and apoptosis in frontal cortex in major depression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16920334 2006 Protective role of Cop in Rip2/caspase-1/caspase-4-mediated HeLa cell death.
16354923 2005 Dysregulation of receptor interacting protein-2 and caspase recruitment domain only protein mediates aberrant caspase-1 activation in Huntington's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383541 2004 INCA, a novel human caspase recruitment domain protein that inhibits interleukin-1beta generation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...