Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.05
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q5BN46 Q5T897 Q8WU44
Symbols PIERCE1
RbEST47

Gene

 Compartment GO Term (1)

AA Sequence

MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTV      1 - 70
HEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDRLNFHPSYNINRPSICD         71 - 136
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18182857 2007 Identification of a novel Rb-regulated gene associated with the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.