Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.59
PubTator Score 1.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.93987657062634E-18
glioblastoma 5572 2.09558027081353E-7
tuberculosis 1563 1.82444424801528E-6
medulloblastoma, large-cell 6234 7.07680639386548E-6
ovarian cancer 8492 7.90038061288535E-5
Rheumatoid Arthritis 1171 0.00357114061174338
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00726369072496224
gastric carcinoma 832 0.023084994475092


  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.004
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.852 0.007
tuberculosis 1.200 0.000
psoriasis 1.400 0.000
gastric carcinoma -3.000 0.023
ovarian cancer 1.400 0.000


Accession Q5BJH7 H7BXS8 Q5JPC2 Q8WY70 Q96C02 Q96IC4
Symbols FinGER8


  Ortholog (14)

AA Sequence

PVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLVR                                        281 - 314

Text Mined References (14)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18685031 2008 Targeting of the 5-HT1A serotonin receptor to neuronal dendrites is mediated by Yif1B.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.