Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.59
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
gastric carcinoma -3.000 2.3e-02
glioblastoma 1.200 2.1e-07
medulloblastoma, large-cell 1.200 7.1e-06
ovarian cancer 1.400 7.9e-05
pancreatic ductal adenocarcinoma liver m... -1.852 7.3e-03
psoriasis 1.400 5.9e-18
Rheumatoid arthritis -1.800 3.6e-03
tuberculosis 1.100 2.5e-07

AA Sequence

MHPAGLAAAAAGTPRLRKWPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHA      1 - 70
AFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQY     71 - 140
QQDTPVAPRFDVNAPDLYIPAMAFITYVLVAGLALGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYL    141 - 210
VTVNTDLTTIDLVAFLGYKYVGMIGGVLMGLLFGKIGYYLVLGWCCVAIFVFMIRTLRLKILADAAAEGV    211 - 280
PVRGARNQLRMYLTMAVAAAQPMLMYWLTFHLVR                                        281 - 314
//

Text Mined References (14)

PMID Year Title