Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Synonym

Accession Q58FF3
Symbols HSP
TRAP1
GRP94b
HSPCP2
TRA1P1
GRP94P1

Gene

PANTHER Protein Class (2)

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MAETIQEVEDEYKAFCKSFSKESDDPVACIHFTAEGEVTFKSILFVPTFVPRGLFDEYGSKKSDYIKLYV      1 - 70
RCVFITDDFRDTMPKNLNFVKGVVDSGGLSLNVSCETLQQHKLLKVIRKKLVHKTLDMIKKIADEKYNDT     71 - 140
FWKEFGTNIKLGVIEDHSNRTCLAKLLRFQSSHHPADITSLHQDVERMKEKQDKICLMAGGYEVIYLTEP    141 - 210
VVEYCIQALPEFDGKRFQNVAKEGVKFDDSEKTKESHEAVEKEFEPLPNWVKDKAIKDKIEKAMVSQCLT    211 - 280
ESLCALVASQYGWSGNMERIMKAQAYQTGKGISTNYHASRKKTFEINPRHPLIRDMLRRIKEDEDDKTVL    281 - 350
DLAVVEEPDEEPEETAEDKEQDKDKEMDVGTDEEKQETAKESTAEKDEL                         351 - 399
//

Text Mined References (2)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.