Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.77
PubTator Score 23.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Spondyloarthropathy 2 3.872 1.9

Gene RIF (2)

AA Sequence

MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGM      1 - 70
AAIQVFEKMNQTHLSGRADEHCVMPPP                                                71 - 97
//

Text Mined References (5)

PMID Year Title