Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.78
PubTator Score 23.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Spondyloarthropathy 2 3.856 1.9

Gene RIF (1)

PMID Text
17339483 POP2 inhibits both the interaction of ASC with various NLR pyrin domains and inhibits NF-kappaB p65 (RelA).

AA Sequence

MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFTSHSCSYWAGM      1 - 70
AAIQVFEKMNQTHLSGRADEHCVMPPP                                                71 - 97
//

Text Mined References (4)

PMID Year Title
24871464 2014 The CLRX.1/NOD24 (NLRP2P) pseudogene codes a functional negative regulator of NF-?B, pyrin-only protein 4.
21362197 2011 Recent evolution of the NF-?B and inflammasome regulating protein POP2 in primates.
17339483 2007 Pyrin-only protein 2 modulates NF-kappaB and disrupts ASC:CLR interactions.
17178784 2007 Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation.