Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Neuromyelitis optica 20 3.712 1.9

Expression

Synonym

Accession Q569G3 Q8IYU7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAAAGRGREQDSARFVYVTRFGSHQCSGVLQLGGRGAQGLWGQGPGAGCRQEKPREAMAVAGVQGGSELP      1 - 70
LGSQLRVPTTPGVEAAASASSQLRASRVQSGTRQSARAGLIQKDAAKKYDFPIPLNEASKIMKKKKKVLV     71 - 140
WNRVYKVISRMLEENEKYRHRLKCQRLSSESSNYTR                                      141 - 176
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.