Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.20
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Neuromyelitis optica 18 3.663 1.8

Expression

AA Sequence

MAAAGRGREQDSARFVYVTRFGSHQCSGVLQLGGRGAQGLWGQGPGAGCRQEKPREAMAVAGVQGGSELP      1 - 70
LGSQLRVPTTPGVEAAASASSQLRASRVQSGTRQSARAGLIQKDAAKKYDFPIPLNEASKIMKKKKKVLV     71 - 140
WNRVYKVISRMLEENEKYRHRLKCQRLSSESSNYTR                                      141 - 176
//

Text Mined References (3)

PMID Year Title