Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.05
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
ependymoma 1.100 1.6e-02
group 3 medulloblastoma 1.300 8.1e-04
intraductal papillary-mucinous carcinoma... 1.200 4.2e-02
invasive ductal carcinoma -1.100 5.6e-03
oligodendroglioma 1.100 9.6e-04
osteosarcoma -1.435 4.2e-05
ovarian cancer -2.100 3.9e-09
primitive neuroectodermal tumor 1.300 2.3e-04
psoriasis -1.300 1.2e-08
Rheumatoid arthritis 1.300 1.6e-02
tuberculosis -1.100 6.3e-07

AA Sequence

MGLPRGPEGQGLPEVETREDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDV      1 - 70
DLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRS     71 - 140
YSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRRYG    141 - 210
FSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEEQRIQSLMTKMTAMANEESRLTASSVGQIVG    211 - 280
LCSAEIKQIVSEYAEKQSELSAEESPEKLGTSQLHRRKVISLNKQIAQKTKHLEELRASHTSLQARYNEA    281 - 350
KKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIEN    351 - 420
LKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPS    421 - 490
RAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFL    491 - 560
RQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKEEGRKNEMLLSKVKAKA    561 - 630
S//

Text Mined References (18)

PMID Year Title