Property Summary

NCBI Gene PubMed Count 25
PubMed Score 6.53
PubTator Score 13.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.3e-07
psoriasis 6685 5.2e-05
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.569 1.8
Orchitis 16 3.15 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.600 5.2e-05
posterior fossa group B ependymoma 1.100 5.3e-07

Gene RIF (7)

PMID Text
26593443 AEP coactivator complex facilitates the initiation of RNAP2-dependent transcription via SL1 activity by loading TBP onto the TATA element.
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
21921199 TAF1B, a subunit of SL1, is structurally related to TFIIB/TFIIB-like proteins; SL1, essential for Pol I recruitment to rRNA gene promoter, also has an essential postpolymerase recruitment role, operating through TAF1B
21921198 findings show that Rrn7, a subunit of the yeast Pol I core factor, and its human ortholog TAF1B are TFIIB-like factors
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19503063 The four most frequently mutated genes in colorectal cancers with microsatellite instability were ACVR2 (92%), TAF1B (84%), ASTE1/HT001 (80%) and TGFBR2 (77%).
12140758 Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability.

AA Sequence

MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTERYQEVTNTDLIPNTQIKALNRGLKKKNNTEK      1 - 70
GWDWYVCEGFQYILYQQAEALKNLGVGPELKNDVLHNFWKRYLQKSKQAYCKNPVYTTGRKPTVLEDNLS     71 - 140
HSDWASEPELLSDVSCPPFLESGAESQSDIHTRKPFPVSKASQSETSVCSGSLDGVEYSQRKEKGIVKMT    141 - 210
MPQTLAFCYLSLLWQREAITLSDLLRFVEEDHIPYINAFQHFPEQMKLYGRDRGIFGIESWPDYEDIYKK    211 - 280
TVEVGTFLDLPRFPDITEDCYLHPNILCMKYLMEVNLPDEMHSLTCHVVKMTGMGEVDFLTFDPIAKMAK    281 - 350
TVKYDVQAVAIIVVVLKLLFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKWEE    351 - 420
ARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAGKKSPSSFQFNWTEEDTDRTCFH    421 - 490
GHSLQGVLKEKGQSLLTKNSLYWLSTQKFCRCYCTHVTTYEESNYSLSYQFILNLFSFLLRIKTSLLHEE    491 - 560
VSLVEKKLFEKKYSVKRKKSRSKKVRRH                                              561 - 588
//

Text Mined References (31)

PMID Year Title
26593443 2015 AF4 uses the SL1 components of RNAP1 machinery to initiate MLL fusion- and AEP-dependent transcription.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21921199 2011 TAF1B is a TFIIB-like component of the basal transcription machinery for RNA polymerase I.
21921198 2011 Yeast Rrn7 and human TAF1B are TFIIB-related RNA polymerase I general transcription factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19503063 2009 Tumor-infiltrating lymphocytes in colorectal cancers with microsatellite instability are correlated with the number and spectrum of frameshift mutations.
17456004 2007 Selective translational repression of truncated proteins from frameshift mutation-derived mRNAs in tumors.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15723054 2005 c-Myc binds to human ribosomal DNA and stimulates transcription of rRNA genes by RNA polymerase I.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12140758 2002 Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability.
11250903 2001 hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters.
11250901 2001 Acetylation of TAF(I)68, a subunit of TIF-IB/SL1, activates RNA polymerase I transcription.
10913176 2000 Repression of RNA polymerase I transcription by the tumor suppressor p53.
10894955 2000 Genomic localization of the human genes TAF1A, TAF1B and TAF1C, encoding TAF(I)48, TAF(I)63 and TAF(I)110 subunits of class I general transcription initiation factor SL1.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
7801130 1994 Assembly of transcriptionally active RNA polymerase I initiation factor SL1 from recombinant subunits.
7801123 1994 Reconstitution of transcription factor SL1: exclusive binding of TBP by SL1 or TFIID subunits.
7491500 1995 Coactivator and promoter-selective properties of RNA polymerase I TAFs.