Property Summary

NCBI Gene PubMed Count 25
PubMed Score 6.53
PubTator Score 13.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.600 0.000
posterior fossa group B ependymoma 1.100 0.000

Synonym

Accession Q53T94 B4DI42 F8WD72 Q15574 Q8WVC3
Symbols SL1
RAF1B
RAFI63
TAFI63
MGC:9349

Gene

Gene RIF (7)

PMID Text
26593443 AEP coactivator complex facilitates the initiation of RNAP2-dependent transcription via SL1 activity by loading TBP onto the TATA element.
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
21921199 TAF1B, a subunit of SL1, is structurally related to TFIIB/TFIIB-like proteins; SL1, essential for Pol I recruitment to rRNA gene promoter, also has an essential postpolymerase recruitment role, operating through TAF1B
21921198 findings show that Rrn7, a subunit of the yeast Pol I core factor, and its human ortholog TAF1B are TFIIB-like factors
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19503063 The four most frequently mutated genes in colorectal cancers with microsatellite instability were ACVR2 (92%), TAF1B (84%), ASTE1/HT001 (80%) and TGFBR2 (77%).
12140758 Identification of MARCKS, FLJ11383 and TAF1B as putative novel target genes in colorectal carcinomas with microsatellite instability.

AA Sequence

MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTERYQEVTNTDLIPNTQIKALNRGLKKKNNTEK      1 - 70
GWDWYVCEGFQYILYQQAEALKNLGVGPELKNDVLHNFWKRYLQKSKQAYCKNPVYTTGRKPTVLEDNLS     71 - 140
HSDWASEPELLSDVSCPPFLESGAESQSDIHTRKPFPVSKASQSETSVCSGSLDGVEYSQRKEKGIVKMT    141 - 210
MPQTLAFCYLSLLWQREAITLSDLLRFVEEDHIPYINAFQHFPEQMKLYGRDRGIFGIESWPDYEDIYKK    211 - 280
TVEVGTFLDLPRFPDITEDCYLHPNILCMKYLMEVNLPDEMHSLTCHVVKMTGMGEVDFLTFDPIAKMAK    281 - 350
TVKYDVQAVAIIVVVLKLLFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKWEE    351 - 420
ARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAGKKSPSSFQFNWTEEDTDRTCFH    421 - 490
GHSLQGVLKEKGQSLLTKNSLYWLSTQKFCRCYCTHVTTYEESNYSLSYQFILNLFSFLLRIKTSLLHEE    491 - 560
VSLVEKKLFEKKYSVKRKKSRSKKVRRH                                              561 - 588
//

Text Mined References (31)

PMID Year Title
26593443 2015 AF4 uses the SL1 components of RNAP1 machinery to initiate MLL fusion- and AEP-dependent transcription.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21921199 2011 TAF1B is a TFIIB-like component of the basal transcription machinery for RNA polymerase I.
21921198 2011 Yeast Rrn7 and human TAF1B are TFIIB-related RNA polymerase I general transcription factors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...