Property Summary

NCBI Gene PubMed Count 10
Grant Count 38
R01 Count 9
Funding $6,682,363.45
PubMed Score 319.94
PubTator Score 140.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
periodontitis -1.100 0.000
medulloblastoma, large-cell 1.100 0.000
Atopic dermatitis -3.000 0.000
breast carcinoma -1.100 0.000
lung adenocarcinoma -1.100 0.000

Gene RIF (4)

PMID Text
22318384 results failed to find an association between ASPRV1 gene mutations and atopic eczema or clinically dry skin in the European populations studied
21542132 SASPase activity is indispensable for processing profilaggrin and maintaining the texture and hydration of the stratum corneum.
16565508 Taps expression is negatively associated with dedifferentiation and malignant progression in squamous cell carcinomas of the skin.
16098038 Identification and characterization of a new member of the aspartic proteases family, a unique epidermal retroviral-like protease, Skin ASpartic Protease.

AA Sequence

MGSPGASLGIKKALQSEQATALPASAPAVSQPTAPAPSCLPKAGQVIPTLLREAPFSSVIAPTLLCGFLF      1 - 70
LAWVAAEVPEESSRMAGSGARSEEGRRQHAFVPEPFDGANVVPNLWLHSFEVINDLNHWDHITKLRFLKE     71 - 140
SLRGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMGKGYYLKGKIGKVPVRFL    141 - 210
VDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSLGKLKLKAQFLVANASAE    211 - 280
EAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH           281 - 343
//

Text Mined References (10)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22318384 2012 Mutations in the SASPase gene (ASPRV1) are not associated with atopic eczema or clinically dry skin.
21542132 2011 SASPase regulates stratum corneum hydration through profilaggrin-to-filaggrin processing.
16565508 2006 A novel aspartic proteinase-like gene expressed in stratified epithelia and squamous cell carcinoma of the skin.
16098038 2005 Identification and characterization of a novel retroviral-like aspartic protease specifically expressed in human epidermis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.