Property Summary

NCBI Gene PubMed Count 10
PubMed Score 354.42
PubTator Score 140.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
periodontitis 293 3.2e-09
lung adenocarcinoma 2716 1.1e-08
medulloblastoma, large-cell 6241 3.1e-05
breast carcinoma 1638 6.3e-05
Atopic dermatitis 952 2.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
retinitis pigmentosa 41 4 4.854 2.4
Social phobia 10 3.312 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -3.000 2.7e-04
breast carcinoma -1.100 6.3e-05
lung adenocarcinoma -1.100 1.1e-08
medulloblastoma, large-cell 1.100 3.1e-05
periodontitis -1.100 3.2e-09

Gene RIF (4)

AA Sequence

MGSPGASLGIKKALQSEQATALPASAPAVSQPTAPAPSCLPKAGQVIPTLLREAPFSSVIAPTLLCGFLF      1 - 70
LAWVAAEVPEESSRMAGSGARSEEGRRQHAFVPEPFDGANVVPNLWLHSFEVINDLNHWDHITKLRFLKE     71 - 140
SLRGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMGKGYYLKGKIGKVPVRFL    141 - 210
VDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSLGKLKLKAQFLVANASAE    211 - 280
EAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH           281 - 343
//

Text Mined References (10)

PMID Year Title