Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.8e-04
astrocytic glioma -1.800 8.8e-03
atypical teratoid / rhabdoid tumor -1.200 7.9e-05
ependymoma -1.800 1.5e-02
group 4 medulloblastoma -1.100 1.1e-03
oligodendroglioma -1.300 4.4e-02
pancreatic ductal adenocarcinoma liver m... -1.265 7.1e-03

Synonym

Accession Q53RE8 Q59FU2 Q8N5X5 Q9P0S5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHY      1 - 70
ASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHGSNPRVVDDDGMTSLHKAAER     71 - 140
GHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDLLSS                               141 - 183
//

Text Mined References (8)

PMID Year Title