Property Summary

NCBI Gene PubMed Count 27
PubMed Score 3.27
PubTator Score 29.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -1.600 8.6e-09
cystic fibrosis -4.034 2.9e-08
dermatomyositis 1.100 1.5e-02
Duchenne muscular dystrophy 1.024 7.9e-08
gastric carcinoma 1.500 7.3e-03
group 3 medulloblastoma 1.900 1.7e-02
intraductal papillary-mucinous carcinoma... -2.100 9.2e-04
juvenile dermatomyositis 1.038 2.5e-09
lung cancer -1.300 4.0e-04
lung carcinoma -1.500 1.7e-13
ovarian cancer 2.400 5.5e-05
pancreatic cancer 2.200 1.5e-04
pancreatic ductal adenocarcinoma liver m... 1.041 2.6e-02
primitive neuroectodermal tumor 1.700 3.5e-02
ulcerative colitis 1.900 2.8e-04

Gene RIF (10)

AA Sequence

MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE      1 - 70
GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ                                        71 - 105
//

Text Mined References (31)

PMID Year Title