Property Summary

NCBI Gene PubMed Count 25
Grant Count 5
R01 Count 1
Funding $418,469.8
PubMed Score 2.60
PubTator Score 29.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
group 3 medulloblastoma 1.900 0.017
cystic fibrosis -4.034 0.000
primitive neuroectodermal tumor 1.700 0.035
Duchenne muscular dystrophy 1.024 0.000
juvenile dermatomyositis 1.038 0.000
primary pancreatic ductal adenocarcinoma 2.363 0.001
intraductal papillary-mucinous carcinoma... -2.100 0.001
lung cancer -2.500 0.000
lung carcinoma -1.500 0.000
Breast cancer -1.600 0.000
gastric carcinoma 1.500 0.007
ulcerative colitis 1.900 0.000
ovarian cancer 2.400 0.000
pancreatic cancer 2.200 0.000
dermatomyositis 1.100 0.015

Gene RIF (8)

PMID Text
25707478 LBH is a candidate gene for synovial pathology in rheumatoid arthritis. It is regulated by growth factors and modulates cell growth in primary fibroblast-like synoviocytes.
25557837 LBH normally induces NPC cell cycle arrest at the G1/S transition, and LBH can suppress the growth of transplanted NPC tumors in vivo by downregulating LMP1-mediated NF-kappaB transcriptional activity.
20606007 LBH is aberrantly overexpressed in mammary tumors of mouse mammary tumor virus (MMTV)-Wnt1-transgenic mice and in aggressive basal subtype human breast cancers that display Wnt/beta-catenin hyperactivation.
20587334 results showed that the interaction of LBH and alphaB-crystallin may inhibit synergistically the transcriptional regulation of p53 and p21
20546612 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17390236 These results suggest that hLBH proteins may act as a transcriptional activator in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
15958514 LBH is implicated as a candidate gene for congenital heart disease associated with partial trisomy 2p syndrome

AA Sequence

MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE      1 - 70
GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ                                        71 - 105
//

Text Mined References (29)

PMID Year Title
25707478 2015 The Rheumatoid Arthritis Risk Gene LBH Regulates Growth in Fibroblast-like Synoviocytes.
25557837 2015 Limb-bud and Heart (LBH) functions as a tumor suppressor of nasopharyngeal carcinoma by inducing G1/S cell cycle arrest.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
20606007 2010 The embryonic transcription cofactor LBH is a direct target of the Wnt signaling pathway in epithelial development and in aggressive basal subtype breast cancers.
20587334 2010 Synergistic efficacy of LBH and alphaB-crystallin through inhibiting transcriptional activities of p53 and p21.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
More...