Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.60
PubTator Score 29.74

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.70063059198666E-13
juvenile dermatomyositis 1189 2.51164588369421E-9
Breast cancer 3099 8.56481922932869E-9
cystic fibrosis 1670 2.86482761720656E-8
Duchenne muscular dystrophy 602 7.94880029334962E-8
lung cancer 4473 3.78503578719647E-6
ovarian cancer 8492 5.51051504137487E-5
pancreatic cancer 2300 1.52644546595843E-4
ulcerative colitis 2087 2.77509281356993E-4
primary pancreatic ductal adenocarcinoma 1271 7.27737388334883E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.22220055134568E-4
gastric carcinoma 832 0.0073241276134215
dermatomyositis 967 0.0148981941731372
group 3 medulloblastoma 2254 0.016700082801386
primitive neuroectodermal tumor 3031 0.0354711561046736


  Differential Expression (15)

Disease log2 FC p
group 3 medulloblastoma 1.900 0.017
cystic fibrosis -4.034 0.000
primitive neuroectodermal tumor 1.700 0.035
Duchenne muscular dystrophy 1.024 0.000
juvenile dermatomyositis 1.038 0.000
primary pancreatic ductal adenocarcinoma 2.363 0.001
intraductal papillary-mucinous carcinoma... -2.100 0.001
lung cancer -2.500 0.000
lung carcinoma -1.500 0.000
Breast cancer -1.600 0.000
gastric carcinoma 1.500 0.007
ulcerative colitis 1.900 0.000
ovarian cancer 2.400 0.000
pancreatic cancer 2.200 0.000
dermatomyositis 1.100 0.015


Accession Q53QV2 B2RBC2 Q9H0Q1 hLBH



  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (8)

25707478 LBH is a candidate gene for synovial pathology in rheumatoid arthritis. It is regulated by growth factors and modulates cell growth in primary fibroblast-like synoviocytes.
25557837 LBH normally induces NPC cell cycle arrest at the G1/S transition, and LBH can suppress the growth of transplanted NPC tumors in vivo by downregulating LMP1-mediated NF-kappaB transcriptional activity.
20606007 LBH is aberrantly overexpressed in mammary tumors of mouse mammary tumor virus (MMTV)-Wnt1-transgenic mice and in aggressive basal subtype human breast cancers that display Wnt/beta-catenin hyperactivation.
20587334 results showed that the interaction of LBH and alphaB-crystallin may inhibit synergistically the transcriptional regulation of p53 and p21
20546612 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17390236 These results suggest that hLBH proteins may act as a transcriptional activator in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
15958514 LBH is implicated as a candidate gene for congenital heart disease associated with partial trisomy 2p syndrome

AA Sequence

GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ                                        71 - 105

Text Mined References (29)

PMID Year Title
25707478 2015 The Rheumatoid Arthritis Risk Gene LBH Regulates Growth in Fibroblast-like Synoviocytes.
25557837 2015 Limb-bud and Heart (LBH) functions as a tumor suppressor of nasopharyngeal carcinoma by inducing G1/S cell cycle arrest.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
20606007 2010 The embryonic transcription cofactor LBH is a direct target of the Wnt signaling pathway in epithelial development and in aggressive basal subtype breast cancers.
20587334 2010 Synergistic efficacy of LBH and alphaB-crystallin through inhibiting transcriptional activities of p53 and p21.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.