Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 5.78446564118243E-7
glioblastoma 5572 1.54534404740694E-4
pediatric high grade glioma 2712 2.40820435463949E-4
group 3 medulloblastoma 2254 0.00156906210921577
astrocytic glioma 2241 0.00176885815256991
oligodendroglioma 2849 0.0441129219676744
subependymal giant cell astrocytoma 2287 0.0441415632797919
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
astrocytic glioma -1.600 0.002
oligodendroglioma -1.600 0.044
glioblastoma -1.100 0.000
pediatric high grade glioma -1.100 0.000
group 3 medulloblastoma -1.100 0.002
subependymal giant cell astrocytoma -1.026 0.044

Synonym

Accession Q53HC5 Q8TAP0 Q9NUX3
Symbols

Gene

  Ortholog (11)

AA Sequence

MAESGGSSGGAGGGGAFGAGPGPERPNSTADKNGALKCTFSAPSHSTSLLQGLATLRAQGQLLDVVLTIN      1 - 70
REAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGVSARGLRHIIDFAYSAEVTLDLDCVQDVLGAA     71 - 140
VFLQMLPVVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEEDFLRLPLERLV    141 - 210
FFLQSNRLQSCAEIDLFRAAVRWLQHDPARRPRASHVLCHIRFPLMQSSELVDSVQTLDIMVEDVLCRQY    211 - 280
LLEAFNYQVLPFRQHEMQSPRTAVRSDVPSLVTFGGTPYTDSDRSVSSKVYQLPEPGARHFRELTEMEVG    281 - 350
CSHTCVAVLDNFVYVAGGQHLQYRSGEGAVDACYRYDPHLNRWLRLQAMQESRIQFQLNVLCGMVYATGG    351 - 420
RNRAGSLASVERYCPRRNEWGYACSLKRRTWGHAGAASGGRLYISGGYGISVEDKKALHCYDPVADQWEF    421 - 490
KAPMSEPRVLHAMVGAGGRIYALGGRMDHVDRCFDVLAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERK    491 - 560
IYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAGIACAPVLLPRAGTRR                   561 - 615
//

Text Mined References (9)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.