Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.90
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q53H82 A8K2D6 Q9Y392
Symbols CGI-83

Gene

PANTHER Protein Class (1)

PDB

4AD9  

Gene RIF (3)

PMID Text
26826708 this study discovered that LACTB2 is an endoribonuclease that is involved in the turnover of mitochondrial RNA, and is essential for mitochondrial function in human cells.
25823027 Disruption of NCOA2 by recurrent fusion with LACTB2 in colorectal cancer
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAI      1 - 70
QEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVL     71 - 140
YTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKI    141 - 210
QQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDP    211 - 280
DKKWKAHL                                                                  281 - 288
//

Text Mined References (12)

PMID Year Title
26826708 2016 Identification of LACTB2, a metallo-?-lactamase protein, as a human mitochondrial endoribonuclease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823027 2016 Disruption of NCOA2 by recurrent fusion with LACTB2 in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...