Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.04
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAI      1 - 70
QEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVL     71 - 140
YTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKI    141 - 210
QQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDP    211 - 280
DKKWKAHL                                                                  281 - 288
//

Text Mined References (13)

PMID Year Title