Property Summary

NCBI Gene PubMed Count 21
PubMed Score 60.04
PubTator Score 11.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

AA Sequence

MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS      1 - 70
SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS     71 - 140
LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA    141 - 210
LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF    211 - 280
PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL    281 - 350
RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC    351 - 420
TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV                                      421 - 456
//

Text Mined References (23)

PMID Year Title