Property Summary

NCBI Gene PubMed Count 20
Grant Count 19
R01 Count 11
Funding $3,954,473.58
PubMed Score 56.85
PubTator Score 11.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25750298 PS-PLA1 expression in colorectal cancer is associated with tumor invasion and metastasis.
25505071 These data suggest that PLA1A plays an important role in bridging the membrane-associated NS2-E2 complex and the NS5A-associated replication complex via its interaction with hepatitis C virus E2, NS2, and NS5A.
24886443 PLA1A2 polymorphism is associated with mortality in participants whose hemoglobin A1c ranges from 5.5% to 6.5%.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of phospholipase A1 member A (PLA1A) in primary human brain microvascular endothelial cells
24368210 Overall, our study shed the light on new structural features of the phospholipase activity of pancreatic lipase family members.
23025307 Microarray analysis indicates HIV-1 Tat-induced upregulation of phospholipase A1 member A (PLA1A) in primary human brain microvascular endothelial cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20573295 These results suggest that the expression of PS-PLA(1) mRNA in THP-1-derived macrophages is activated via TLR4.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19632984 Data show that iPLA(1)gamma is a novel membrane transport factor that contributes to a specific Golgi-to-ER retrograde pathway distinct from presently characterized COPI- and Rab6-dependent pathways.
More...

AA Sequence

MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS      1 - 70
SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS     71 - 140
LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA    141 - 210
LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF    211 - 280
PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL    281 - 350
RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC    351 - 420
TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV                                      421 - 456
//

Text Mined References (22)

PMID Year Title
25750298 2015 Phosphatidylserine-specific phospholipase A1 (PS-PLA1) expression in colorectal cancer correlates with tumor invasion and hematogenous metastasis.
25505071 2015 Phosphatidylserine-specific phospholipase A1 involved in hepatitis C virus assembly through NS2 complex formation.
24886443 2014 PLA1A2 platelet polymorphism predicts mortality in prediabetic subjects of the population based KORA S4-Cohort.
24368210 2014 Kinetic and structural characterization of triacylglycerol lipases possessing phospholipase A1 activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20573295 2010 Expression of phosphatidylserine-specific phospholipase A(1) mRNA in human THP-1-derived macrophages.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19632984 2009 Intracellular phospholipase A1gamma (iPLA1gamma) is a novel factor involved in coat protein complex I- and Rab6-independent retrograde transport between the endoplasmic reticulum and the Golgi complex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...