Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.97068128633463E-4
ulcerative colitis 2087 0.00103214545609517
colon cancer 1475 0.00421329985112129
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00431691077650836

Synonym

Accession Q53H64 Q9NWQ1
Symbols C17orf73

Gene

 Compartment GO Term (0)

AA Sequence

MGRRSPFKPRNKVFGFSYPWCRSYQPFPRKRAWPPSRVWLGACCASLASPPKGTIPSGEYYRPAPSSSGD      1 - 70
SLRRESGALLQYLPSLASPCANHATRCSLLFPIYKIKMTLLYLTGLARTHCCYLADRCAEAVESAFYLVG     71 - 140
SLCINARGAAHLTD                                                            141 - 154
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.