Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q53H64 Q9NWQ1
Symbols C17orf73

 Compartment GO Term (0)

AA Sequence

MGRRSPFKPRNKVFGFSYPWCRSYQPFPRKRAWPPSRVWLGACCASLASPPKGTIPSGEYYRPAPSSSGD      1 - 70
SLRRESGALLQYLPSLASPCANHATRCSLLFPIYKIKMTLLYLTGLARTHCCYLADRCAEAVESAFYLVG     71 - 140
SLCINARGAAHLTD                                                            141 - 154
//

Text Mined References (4)

PMID Year Title