Property Summary

NCBI Gene PubMed Count 30
PubMed Score 75.32
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 1.2e-03
non primary Sjogren syndrome sicca -1.200 2.4e-02
ovarian cancer 1.600 2.9e-04
pituitary cancer 1.200 5.0e-06

Protein-protein Interaction (5)

Gene RIF (21)

AA Sequence

MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPA      1 - 70
ACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTD     71 - 140
EATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKEQPVFAMTGLR    141 - 210
WGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRIL    211 - 280
RRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGS    281 - 350
RKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP    351 - 420
TQ                                                                        421 - 422
//

Text Mined References (35)

PMID Year Title