Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
Funding $81,780.8
PubMed Score 67.79
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001
non primary Sjogren syndrome sicca -1.200 0.024
ovarian cancer 1.600 0.000
pituitary cancer 1.200 0.000

Synonym

Accession Q53H12 Q75KN1 Q96GC3 Q9NP48 hAGK
Symbols MULK
CATC5
CTRCT38
MTDPS10

Gene

AGK

 Grant Application (2)

Gene RIF (16)

PMID Text
25960215 miR-194 could reduce the phosphoinositide 3-kinase (PI3K)/AKT/FoxO3a signaling pathway by suppressing acylglycerol kinase (AGK) directly.
25872568 AGK promotes the proliferation and cell cycle progression of oral squamous cell carcinoma.
25474138 findings provide new evidence that AGK plays an important role in promoting angiogenesis and providing resistance to apoptosis in hepatocellular carcinoma
25208612 compare our findings to those in 21 previously reported AGK mutation-positive Sengers patients, confirming that Sengers syndrome is a clinically recognisable disorder of mitochondrial energy metabolism
24886245 AGK promotes cell proliferation and tumorigenicity in breast cancer via suppression of the FOXO1.
23676499 AGK expression was significantly correlated with JAK2/STAT3 hyperactivation in esophageal squamous cell carcinoma, as well as in lung and breast cancer.
23266196 study reports 2 families with Sengers syndrome and mutations in the acylglycerol kinase gene; 1 proband had abnormal mitochondria with citrate synthase crystals, associated with high citrate synthase activity; these pedigrees confirm that mutation of AGK is responsible for the severe neonatal presentation of Sengers syndrome
22864860 Our findings suggest that ATX-AGK-LPA signaling axis might be an important player in the development and progression of diabetic retinopathy.
22415731 This is the first mutation in AGK gene to be implicated in the development of isolated cataract.
22284826 The loss of AGK led to a decrease of the adenine nucleotide translocator in the inner mitochondrial membrane in muscle.
More...

AA Sequence

MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPA      1 - 70
ACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTD     71 - 140
EATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATLAIVKGETVPLDVLQIKGEKEQPVFAMTGLR    141 - 210
WGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRIL    211 - 280
RRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGS    281 - 350
RKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP    351 - 420
TQ                                                                        421 - 422
//

Text Mined References (30)

PMID Year Title
25960215 2015 miR-194 regulated AGK and inhibited cell proliferation of oral squamous cell carcinoma by reducing PI3K-Akt-FoxO3a signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25872568 2015 Acylglycerol kinase promotes the proliferation and cell cycle progression of oral squamous cell carcinoma.
25474138 2014 AGK enhances angiogenesis and inhibits apoptosis via activation of the NF-?B signaling pathway in hepatocellular carcinoma.
25208612 2014 Sengers syndrome: six novel AGK mutations in seven new families and review of the phenotypic and mutational spectrum of 29 patients.
24886245 2014 Acylglycerol kinase promotes cell proliferation and tumorigenicity in breast cancer via suppression of the FOXO1 transcription factor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23676499 2013 Acylglycerol kinase augments JAK2/STAT3 signaling in esophageal squamous cells.
23266196 2013 Mitochondrial citrate synthase crystals: novel finding in Sengers syndrome caused by acylglycerol kinase (AGK) mutations.
22864860 2013 Expression of lysophosphatidic acid, autotaxin and acylglycerol kinase as biomarkers in diabetic retinopathy.
More...