Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.37
PubTator Score 22.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.217 1.4e-04
Breast cancer -3.300 2.6e-21
breast carcinoma -1.400 5.8e-16
colon cancer -2.800 7.8e-05
ductal carcinoma in situ -1.600 1.6e-02
ependymoma 1.600 1.5e-06
gastric carcinoma 2.700 1.2e-02
glioblastoma 1.700 2.2e-02
group 4 medulloblastoma -2.400 4.3e-06
intraductal papillary-mucinous adenoma (... -2.000 2.9e-05
intraductal papillary-mucinous carcinoma... -2.300 1.0e-05
intraductal papillary-mucinous neoplasm ... -2.200 5.0e-04
invasive ductal carcinoma -1.400 4.1e-02
lung adenocarcinoma -1.300 2.2e-07
lung cancer -1.100 4.0e-03
lung carcinoma -2.200 8.6e-13
medulloblastoma, large-cell -1.800 1.4e-03
non-small cell lung cancer -1.202 2.3e-08
ovarian cancer -2.800 1.6e-10
pancreatic cancer 1.300 6.5e-03
pituitary cancer -1.400 1.5e-03
primary pancreatic ductal adenocarcinoma 1.283 1.5e-02
psoriasis -1.700 3.0e-05
subependymal giant cell astrocytoma 2.080 1.6e-02

Gene RIF (6)

AA Sequence

MPQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIK      1 - 70
AAAHQLCLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQDGNYFEHKHNIRPKPFVIPGRSSGCSTPSG     71 - 140
IDCGSGRSTPSSVSTVSTICPGDLKVAAKLAPNIPLEMELPGVKIVHAQFNTPMQLYSDDNIMETLQGQV    141 - 210
STALGETPLMSEPTASVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTK    211 - 280
VHGGSGGAQRMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFIEGELYCETHARARTK    281 - 350
PPEGYDTVTLYPKA                                                            351 - 364
//

Text Mined References (22)

PMID Year Title