Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 4
Funding $387,455.5
PubMed Score 14.98
PubTator Score 22.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26214276 This study confirmed that PDLIM3 as genetic modifiers of age at onset of Alzheimer disease.
21549096 two abnormal splicing events for actinin-associated LIM protein 3 (PDLIM3/ALP) and fibronectin 1 (FN1) in the skeletal muscles of myotonic dystrophy type 1 patients.
20801532 mutations in PDLIM3 and MYPN are infrequent in hypertrophic cardiomyopathies
19412328 Observational study of gene-disease association. (HuGE Navigator)
17254821 Mutations in PDLIM3 and MYOZ1, encoding myocyte Z line proteins, do not play any significant role in the genetic etiology of idiopathic DCM.
15084604 ZASP-like motif in actinin-associated LIM protein is required for interaction with the alpha-actinin rod and for targeting to the muscle Z-line

AA Sequence

MPQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIK      1 - 70
AAAHQLCLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQDGNYFEHKHNIRPKPFVIPGRSSGCSTPSG     71 - 140
IDCGSGRSTPSSVSTVSTICPGDLKVAAKLAPNIPLEMELPGVKIVHAQFNTPMQLYSDDNIMETLQGQV    141 - 210
STALGETPLMSEPTASVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTK    211 - 280
VHGGSGGAQRMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFIEGELYCETHARARTK    281 - 350
PPEGYDTVTLYPKA                                                            351 - 364
//

Text Mined References (22)

PMID Year Title
26214276 2015 Genetic Modifiers of Age at Onset in Carriers of the G206A Mutation in PSEN1 With Familial Alzheimer Disease Among Caribbean Hispanics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
21549096 2011 Alternative splicing of PDLIM3/ALP, for ?-actinin-associated LIM protein 3, is aberrant in persons with myotonic dystrophy.
21269460 2011 Initial characterization of the human central proteome.
20801532 2010 Analysis of the Z-disc genes PDLIM3 and MYPN in patients with hypertrophic cardiomyopathy.
19412328 2008 Coding sequence mutations identified in MYH7, TNNT2, SCN5A, CSRP3, LBD3, and TCAP from 313 patients with familial or idiopathic dilated cardiomyopathy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17258832 2007 Characterization of lobulated fibers in limb girdle muscular dystrophy type 2A by gene expression profiling.
More...