Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.224 1.2e-02
cystic fibrosis and chronic rhinosinusit... -1.025 4.1e-02
ependymoma 2.000 5.1e-10
fibroadenoma 1.200 7.0e-04
malignant mesothelioma -1.700 6.4e-06
nasopharyngeal carcinoma -1.100 1.8e-07

Synonym

Accession Q53FD0 E9PJQ0 Q9BTA8 Q9H5S9
Symbols FAM164C
C14orf140

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYT      1 - 70
HPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFP     71 - 140
LKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEW    141 - 210
VQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKGNKSNT    211 - 280
MYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSGPFQFSDYRIQRLKRERLVASNNKIRDPVSEPSVEKF    281 - 350
SPPSETPVGALQGSARNSSLSMAPDSSGSSGSIEEPQLGECSHCGRKFLSFRLERHSNICSRMRGSKRKV    351 - 420
FDSSRARAKGTELEQYLNWKGPASAKAEPPQKSNWR                                      421 - 456
//

Text Mined References (8)

PMID Year Title