Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.01065630601359E-13
nasopharyngeal carcinoma 1056 1.75444840424649E-7
malignant mesothelioma 3163 6.35228264449482E-6
fibroadenoma 557 6.99208982721375E-4
chronic rhinosinusitis 512 0.0118994464232369
cystic fibrosis and chronic rhinosinusitis 213 0.0414146373805627

Expression

  Differential Expression (6)

Synonym

Accession Q53FD0 E9PJQ0 Q9BTA8 Q9H5S9
Symbols FAM164C
C14orf140

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYT      1 - 70
HPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFP     71 - 140
LKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEW    141 - 210
VQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKGNKSNT    211 - 280
MYKPIFSPEFEFEEEFSRDRREDETWGRSQQNSGPFQFSDYRIQRLKRERLVASNNKIRDPVSEPSVEKF    281 - 350
SPPSETPVGALQGSARNSSLSMAPDSSGSSGSIEEPQLGECSHCGRKFLSFRLERHSNICSRMRGSKRKV    351 - 420
FDSSRARAKGTELEQYLNWKGPASAKAEPPQKSNWR                                      421 - 456
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.