Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.69
PubTator Score 7.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 6.4e-05
atypical teratoid / rhabdoid tumor 1.300 6.2e-07
glioblastoma -1.300 7.9e-06
group 3 medulloblastoma 1.200 1.1e-03
medulloblastoma, large-cell 1.300 1.2e-03
osteosarcoma -2.470 9.2e-09
ovarian cancer -1.600 6.5e-06
primitive neuroectodermal tumor 1.100 2.5e-03
psoriasis -1.200 4.2e-04

Gene RIF (1)

AA Sequence

MAAVRGLRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENK      1 - 70
AGSFITGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVDEMSTQD     71 - 140
VFSYFKEYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSS    141 - 210
DDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYY    211 - 280
MKYGNPNYGGMKGILSNSWKRRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEE    281 - 350
EEEEEEEEEDQDMDADDRVVVEYHEELPALKQPRERSASRRSSASSSDSDEMDYDLELKMISTPSPKKSM    351 - 420
KMTMYADEVESQLKNIRNSMRADSVSSSNIKNRIGNKLPPEKFADVRHLLDEKRQHSRPRPPVSSTKSDI    421 - 490
RQRLGKRPHSPEKAFSSNPVVRREPSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNT    491 - 560
KKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSRLDNLPSLQIEVSRESSSGSEAES              561 - 620
//

Text Mined References (21)

PMID Year Title