Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.21

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.300 1.1e-10
Astrocytoma, Pilocytic 1.300 3.3e-04
atypical teratoid / rhabdoid tumor -1.400 1.8e-02
group 3 medulloblastoma -1.800 6.1e-05
lung adenocarcinoma -1.100 6.4e-08
medulloblastoma, large-cell -1.400 9.5e-06
oligodendroglioma 1.100 4.0e-02
osteosarcoma 2.259 2.2e-05

Synonym

Accession Q52LD8 Q14DH4 Q2TA69 Q53QE0 Q53SE1 Q96NM3
Symbols C2orf11
Raftlin-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYY      1 - 70
LKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAA     71 - 140
KELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESG    141 - 210
IEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTL    211 - 280
DADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIE    281 - 350
GCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKG    351 - 420
EDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFD    421 - 490
QEDGVTQVTCM                                                               491 - 501
//

Text Mined References (6)

PMID Year Title