Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 9.0e-10
lung carcinoma 2843 4.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
post-traumatic stress disorder 40 3.471 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.100 4.6e-04
ovarian cancer 1.100 9.0e-10

Synonym

Accession Q52LC2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MRLWKARVLKLVLKTAKDSRLGLNSKWLSLKLGDAGNPRSLAIRFILTNYNKLSIQSWFSLRRVEIISNN      1 - 70
SIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQD     71 - 140
CASSFSPAFLIGLAMSLILLLVLAYALHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAE    141 - 210
CYKLRSQQISKIYV                                                            211 - 224
//

Text Mined References (5)

PMID Year Title